@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMM6: (2017-11-09 )
MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEVKVLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITNDDIRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQRQRTALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSEAVQLADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_B_9(4HLU)
ECFA2_THEMA
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




ANP_A_6(4ZIR)
ECFA2_THEMA
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ADP_A_5(4HLU)
ECFA2_THEMA
[Raw transfer]




23 PsiBlast_CBE 85.8441% -70 - C1 -3PUZ - MALK_ECOLI -
19 PsiBlast_PDB 84.9541% -72 - C1 -4KI0 - MALK_ECOLI -
22 PsiBlast_CBE 84.8341% -71 - C1 -3RLF - MALK_ECOLI -
155 HHSearch 84.7740% -38 - C1 -3RLF - MALK_ECOLI -
156 HHSearch 84.6340% -38 - C1 -2AWN - MALK_ECOLI -
16 PsiBlast_PDB 84.2041% -70 - C1 -3RLF - MALK_ECOLI -
14 PsiBlast_PDB 84.1141% -73 - C1 -3PUW - MALK_ECOLI -
36 PsiBlast_CBE 84.0441% -69 - C1 -2R6G - MALK_ECOLI (first) -
15 PsiBlast_PDB 84.0441% -71 - C1 -3PUX - MALK_ECOLI -
13 PsiBlast_PDB 83.8541% -69 - C1 -3PUV - MALK_ECOLI -
35 PsiBlast_CBE 83.5141% -76 - C1 -2R6G - MALK_ECOLI (first) -
18 PsiBlast_PDB 83.5041% -71 - C1 -4KHZ - ? -
30 PsiBlast_CBE 83.2941% -60 - C1 -2AWN - MALK_ECOLI -
10 PsiBlast_PDB 82.5141% -70 - C1 -3PUY - MALK_ECOLI -
11 PsiBlast_PDB 82.4941% -70 - C1 -3PUZ - MALK_ECOLI -
24 PsiBlast_CBE 82.4241% -71 - C1 -3PUY - MALK_ECOLI -
25 PsiBlast_CBE 82.0441% -66 - C1 -3PUX - MALK_ECOLI -
27 PsiBlast_CBE 81.9341% -67 - C1 -3PUV - MALK_ECOLI -
21 PsiBlast_CBE 81.6941% -69 - C1 -4KI0 - MALK_ECOLI -
17 PsiBlast_PDB 81.6941% -61 - C1 -4JBW - MALK_ECOLI -
57 PsiBlast_CBE 80.3139% -49 - C1 -2OLJ 5.8 ?
52 PsiBlast_CBE 79.1639% -49 - C1 -2OLK 6.3 ?
44 PsiBlast_CBE 78.7439% -46 - C1 -3C41 6.0 ?
43 PsiBlast_CBE 78.5739% -48 - C1 -3C4J 6.8 ?
41 PsiBlast_CBE 78.5240% -32 - C1 -4U00 6.1 ?
42 PsiBlast_CBE 78.1039% -47 - C1 -3C4J 5.2 ?
54 PsiBlast_CBE 78.0939% -51 - C1 -2OLK 6.4 ?
45 PsiBlast_CBE 78.0939% -47 - C1 -3C41 6.7 ?
47 PsiBlast_CBE 77.8439% -47 - C1 -2Q0H 5.7 ?
53 PsiBlast_CBE 77.2739% -53 - C1 -2OLK 6.2 ?
159 HHSearch 77.1337% -24 - C1 -3FVQ 7.6 FBPC_NEIG1
55 PsiBlast_CBE 77.0539% -49 - C1 -2OLK 6.2 ?
46 PsiBlast_CBE 76.0039% -46 - C1 -2Q0H 6.0 ?
56 PsiBlast_CBE 75.5739% -42 - C1 -2OLJ 5.8 ?
62 PsiBlast_CBE 70.3237% -44 - C1 -4YMU 5.7 ?
63 PsiBlast_CBE 70.2237% -44 - C1 -4YMU 6.0 ?
68 PsiBlast_CBE 69.5238% -18 - C1 -3FVQ 7.6 FBPC_NEIG1
69 PsiBlast_CBE 67.3838% -14 - C1 -3FVQ 7.1 FBPC_NEIG1
61 PsiBlast_CBE 67.2537% -43 - C1 -4YMV 5.1 ?
60 PsiBlast_CBE 67.1537% -46 - C1 -4YMV 5.3 ?
95 PsiBlast_CBE 63.2033% -24 - C1 -4HLU 4.9 ECFA2_THEMA
96 PsiBlast_CBE 62.5633% -24 - C1 -4HLU 4.5 ECFA2_THEMA
97 PsiBlast_CBE 60.4933% -17 - C1 -4ZIR 4.6 ECFA2_THEMA
98 PsiBlast_CBE 55.3835% -27 - C1 -2FF7 5.4
100 PsiBlast_CBE 53.7135% -30 - C1 -2PMK 5.4
102 PsiBlast_CBE 51.9834% -28 - C1 -3B5J 5.6
116 PsiBlast_CBE 51.4034% -21 - C1 -2FFA 5.3
119 PsiBlast_CBE 51.2134% 1 - C1 -1XEF 6.2 HLYBP_ECOLX
112 PsiBlast_CBE 50.9434% -2 - C1 -2FGJ 5.6
120 PsiBlast_CBE 50.8234% -1 - C1 -1XEF 5.0 HLYBP_ECOLX
117 PsiBlast_CBE 50.4934% -1 - C1 -1XEF 5.8
103 PsiBlast_CBE 50.3134% -9 - C1 -2FGK 6.2
106 PsiBlast_CBE 49.9334% -10 - C1 -2FGK 6.4 HLYBP_ECOLX
114 PsiBlast_CBE 49.9034% -7 - C1 -2FGJ 6.0 HLYBP_ECOLX
115 PsiBlast_CBE 49.6734% -7 - C1 -2FGJ 5.8 HLYBP_ECOLX
118 PsiBlast_CBE 49.0234% -4 - C1 -1XEF 5.7 HLYBP_ECOLX
105 PsiBlast_CBE 47.8234% -5 - C1 -2FGK 6.3 HLYBP_ECOLX
104 PsiBlast_CBE 47.5834% -13 - C1 -2FGK 5.6 HLYBP_ECOLX
113 PsiBlast_CBE 47.5634% -2 - C1 -2FGJ 5.8 HLYBP_ECOLX