@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMN9: (2017-11-09 )
MKKLVLGGLSAAIMAVSGSVMAADFVAGKDYTVIANPGKVEVPGKIEVREFFWYGCLHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

WEF_A_3(4WET)
?
[Raw transfer]




EG6_B_4(4WEY)
?
[Raw transfer]




EDO_B_4(4WET)
?
[Raw transfer]




GOL_A_3(4ZL8)
DSBA_PSEAE
[Raw transfer]




GOL_A_3(5DCH)
DSBA_PSEAE
[Raw transfer]




EDO_B_3(4WEY)
?
[Raw transfer]




58 HHSearch 89.6699%-109 - C2 -4P3Y - ? -
1 PsiBlast_PDB 88.8699%-108 - C2 -4P3Y - ? -
4 PsiBlast_PDB 75.1643%-111 - C2 -3H93 - DSBA_PSEAE -
5 PsiBlast_PDB 74.1342%-108 - C2 -4ZL7 - DSBA_PSEAE -
66 HHSearch 73.3243%-101 - C2 -5TLQ - DSBA_PSEAE -
3 PsiBlast_PDB 72.9643%-104 - C2 -5TLQ - DSBA_PSEAE -
7 PsiBlast_PDB 72.8142%-107 - C2 -4ZL9 - DSBA_PSEAE -
70 HHSearch 72.7842%-103 - C2 -4ZL8 2.2 DSBA_PSEAE
6 PsiBlast_PDB 72.6742%-106 - C2 -4ZL8 - DSBA_PSEAE -
8 PsiBlast_PDB 72.0242%-106 - C2 -5DCH 2.2 DSBA_PSEAE
2 PsiBlast_PDB 71.3743%-107 - C2 -2MBT - DSBA_PSEAE -
11 PsiBlast_PDB 66.3234% -96 - C2 -3HD5 - DSBA_BORPA -
71 HHSearch 64.4532% -88 - C2 -3HD5 - DSBA_BORPA -
64 HHSearch 63.0835% -11 - C2 -2REM - ? -
65 HHSearch 61.7235% -12 - C2 -2REM - ? -
10 PsiBlast_PDB 60.9636% -11 - C2 -2REM - ? -
9 PsiBlast_PDB 60.4736% -21 - C2 -4K2D - ? -
69 HHSearch 59.5429% -13 - C2 -4JRR - ? -
68 HHSearch 58.8829% -11 - C2 -4JRR - ? -
62 HHSearch 58.7035% -1 - C2 -4K2D - ? -