@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMQ3: (2017-11-09 )
MSKALPIAVAVVLGGAALVPVYYATQHPTTEVGHKADKNASPIQKISYVLGYEVAQQTPPELDTKAFVQGIHDVRNKQPSAYTQEDLKAAVAAYEKELQQKMQHQDKPEQAGTATDSADAQFLAENKTKAGVKTTASGLQYIITKEGTGKQPTAQSIVKVHYEGRLINGQVFDSSYKRGQPVEFPLNQVIPGWTEGLQLMKEGGKATFFIPSNLAYGPQELPGIPANSTLIFDVELISVK

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

854_B_4(4FN2)
SMT3_YEAST
[Raw transfer]




ARD_C_3(3FAP)
FKB1A_HUMAN
[Raw transfer]




861_B_6(4G50)
SMT3_YEAST
[Raw transfer]




FK5_A_3(1Q6I)
FKBA_ECOLI
[Raw transfer]




861_B_10(4GGQ)
SMT3_YEAST
[Raw transfer]




854_A_3(4FN2)
SMT3_YEAST
[Raw transfer]




FK5_A_3(1Q6I)
FKBA_ECOLI
[Raw transfer]




1PE_A_2(3O5L)
FKBP5_HUMAN
[Raw transfer]




858_E_5(1QPF)
FKB1A_HUMAN
[Raw transfer]




RAP_B_2(1FKL)
FKB1A_BOVIN
[Raw transfer]




6UO_A_5(5KLX)
?
[Raw transfer]




4GI_A_3(4GIV)
SMT3_YEAST
[Raw transfer]




6UO_C_10(5KLX)
?
[Raw transfer]




RAP_A_2(2VCD)
MIP_LEGPH
[Raw transfer]




TLA_A_2(5XB0)
?
[Raw transfer]




TLA_A_2(5XB0)
?
[Raw transfer]




MPO_A_2(3UQI)
?
[Raw transfer]




PEG_D_8(2PBC)
FKBP2_HUMAN
[Raw transfer]




PEG_C_7(2PBC)
FKBP2_HUMAN
[Raw transfer]




PEG_A_5(2PBC)
FKBP2_HUMAN
[Raw transfer]




PEG_B_6(2PBC)
FKBP2_HUMAN
[Raw transfer]




JZF_A_2(2KO7)
?
[Raw transfer]




DMS_A_3(3O5Q)
FKBP5_HUMAN
[Raw transfer]




L2S_A_2(2L2S)
?
[Raw transfer]




B7G_D_4(1QPF)
FKB1A_HUMAN
[Raw transfer]




FK5_F_14(5HW8)
FKBP_CANAL
[Raw transfer]




FK5_C_11(5HW8)
FKBP_CANAL
[Raw transfer]




FK5_A_9(5HW8)
FKBP_CANAL
[Raw transfer]




FK5_G_15(5HW8)
FKBP_CANAL
[Raw transfer]




3JR_A_3(4W9P)
FKBP5_HUMAN
[Raw transfer]




3JR_E_4(4W9P)
FKBP5_HUMAN
[Raw transfer]




3JQ_E_4(4W9O)
FKBP5_HUMAN
[Raw transfer]




FK5_F_14(5HW8)
FKBP_CANAL
[Raw transfer]




FK5_E_13(5HW8)
FKBP_CANAL
[Raw transfer]




FK5_D_12(5HW8)
FKBP_CANAL
[Raw transfer]




4 PsiBlast_PDB 75.1039% -40 - C5 -1Q6U - FKBA_ECOLI -
3 PsiBlast_PDB 71.6536% 98 - C5 -1Q6I 6.7 FKBA_ECOLI
2 PsiBlast_PDB 71.5236% 100 - C5 -1Q6H - FKBA_ECOLI -
121 HHSearch 71.1835% 99 - C5 -1Q6I 6.7 FKBA_ECOLI
110 Fugue 69.5038% 38 - C5 -1FD9 - MIP_LEGPH -
120 HHSearch 69.2938% 37 - C5 -1FD9 - MIP_LEGPH -
122 HHSearch 68.9035% 101 - C- -1Q6H - FKBA_ECOLI -
1 PsiBlast_PDB 68.6738% 52 - C5 -1FD9 - MIP_LEGPH -
30 PsiBlast_CBE 66.1240% 43 - C5 -4G50 5.2 SMT3_YEAST
31 PsiBlast_CBE 65.3440% 45 - C5 -4FN2 5.7 SMT3_YEAST
19 PsiBlast_PDB 65.2840% 49 - C5 -4FN2 5.4 SMT3_YEAST
24 PsiBlast_CBE 64.7441% -6 - C5 -4GGQ - SMT3_YEAST -
11 PsiBlast_PDB 64.5841% 31 - C5 -5KLX 5.3 ?
6 PsiBlast_PDB 64.5453% -59 - C5 -2VCD 6.8 MIP_LEGPH
20 PsiBlast_PDB 64.5140% 46 - C5 -4G50 - SMT3_YEAST -
125 HHSearch 64.3042% -54 - C5 -5XB0 2.5 ?
8 PsiBlast_PDB 64.2042% 51 - C5 -3UQA - SMT3_YEAST -
27 PsiBlast_CBE 64.1248% -23 - C5 -4DZ3 - ? -
12 PsiBlast_PDB 63.9440% 48 - C5 -3VAW - SMT3_YEAST -
14 PsiBlast_PDB 63.8548% -23 - C5 -2Y78 - ? -
32 PsiBlast_CBE 62.1542% -76 - C5 -5XB0 2.5 ?
17 PsiBlast_PDB 61.0848% -18 - C5 -2L2S 3.6 ?
86 PsiBlast_CBE 57.2642% 29 - C5 -1FKL 7.2 FKB1A_BOVIN
100 PsiBlast_CBE 56.4840% 26 - C5 -3FAP 6.7 FKB1A_HUMAN
71 PsiBlast_CBE 56.3340% 21 - C5 -3O5L 3.2 FKBP5_HUMAN
68 PsiBlast_CBE 56.1340% 24 - C5 -3O5Q 2.5 FKBP5_HUMAN
107 PsiBlast_CBE 55.9840% 32 - C5 -1QPF 3.3 FKB1A_HUMAN
52 PsiBlast_CBE 55.8240% 18 - C5 -4W9O 2.5 FKBP5_HUMAN
49 PsiBlast_CBE 55.4540% 12 - C5 -4W9P 3.7 FKBP5_HUMAN
50 PsiBlast_CBE 55.3040% 18 - C5 -4W9P 2.5 FKBP5_HUMAN
37 PsiBlast_CBE 53.2745% -19 - C5 -3UQI 2.5 ?
89 PsiBlast_CBE 52.2544% -12 - C5 -2PBC 2.5 FKBP2_HUMAN
88 PsiBlast_CBE 51.0644% -13 - C5 -2PBC 2.0 FKBP2_HUMAN
90 PsiBlast_CBE 50.8444% -17 - C5 -2PBC 2.5 FKBP2_HUMAN
91 PsiBlast_CBE 50.5444% -15 - C5 -2PBC 2.6 FKBP2_HUMAN
79 PsiBlast_CBE 48.6044% 12 - C5 -5HW8 2.7 FKBP_CANAL
81 PsiBlast_CBE 46.9144% 29 - C5 -5HW8 2.8 FKBP_CANAL
76 PsiBlast_CBE 46.8944% 19 - C5 -5HW8 2.1 FKBP_CANAL
78 PsiBlast_CBE 45.3044% 15 - C5 -5HW8 2.9 FKBP_CANAL
75 PsiBlast_CBE 44.6044% 3 - C5 -5HW8 3.1 FKBP_CANAL
77 PsiBlast_CBE 44.3744% 15 - C5 -5HW8 2.2 FKBP_CANAL