@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMU6: (2017-11-10 )
MTDSEEYHLPQHVAIIMDGNNRFAKKNQMQKGDGHREGKNVLDPIVEHCVKTGVRALTVFAFSSENWNRPQYEVDLLMKLLEETIHEQIPRMKKFNIALRFIGDRSRLPSHLVALMEDAEQQTAHHDAMTLTIAVSYGGMWDIANAAKQVAQAVSRGEIDADQINVDLFENYVSLNDLPAVDLLIRTGRDFRISNFLLWQAAYAELYFTDTLWPEFTVEEFDHALNVFSGRERRFGKTSEQIQQEKIEKL

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

B08_A_3(2E99)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




IPR_C_7(5HXP)
ZFPS_SOLHA
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




B29_B_7(2E98)
UPPS_ECOLI
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




DST_B_7(5HXT)
ZFPS_SOLHA
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




DPO_B_14(2VG2)
DPDS_MYCTU
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




DST_A_4(5HXT)
ZFPS_SOLHA
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




IPR_C_8(5HXP)
ZFPS_SOLHA
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B29_A_4(2E98)
UPPS_ECOLI
[Raw transfer]




DST_A_3(5HXQ)
ZFPS_SOLHA
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




IPR_A_3(5HXP)
ZFPS_SOLHA
[Raw transfer]




IPR_A_3(5HXP)
ZFPS_SOLHA
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




IPE_G_7(1X08)
UPPS_ECOLI
[Raw transfer]




37 PsiBlast_CBE 96.1847%-141 - C6 -1UEH - UPPS_ECOLI -
2 PsiBlast_PDB 95.7547%-133 - C6 -1V7U 6.5 UPPS_ECOLI
36 PsiBlast_CBE 95.6647%-142 - C6 -1V7U - UPPS_ECOLI -
12 PsiBlast_PDB 95.5847%-134 - C6 -3SGT - UPPS_ECOL6 -
39 PsiBlast_CBE 95.1647%-132 - C6 -1X09 3.6 UPPS_ECOLI
40 PsiBlast_CBE 94.9747%-131 - C6 -1X08 7.2 UPPS_ECOLI
4 PsiBlast_PDB 94.6347%-136 - C6 -1X07 4.5 UPPS_ECOLI
84 HHSearch 94.5846%-132 - C6 -1X09 3.6 UPPS_ECOLI
15 PsiBlast_PDB 93.8647%-141 - C6 -3SH0 - UPPS_ECOLI -
3 PsiBlast_PDB 93.7347%-127 - C6 -1X06 7.5 UPPS_ECOLI
27 PsiBlast_CBE 93.4247%-139 - C6 -3WYJ - UPPS_ECOLI -
30 PsiBlast_CBE 93.4047%-138 - C6 -3SGV 6.5 UPPS_ECOLI
6 PsiBlast_PDB 92.3447%-127 - C6 -2E99 6.2 UPPS_ECOLI
9 PsiBlast_PDB 92.1947%-137 - C6 -2E9D 4.9 UPPS_ECOLI
1 PsiBlast_PDB 92.1447%-143 - C6 -1UEH - UPPS_ECOLI -
34 PsiBlast_CBE 91.9047%-144 - C6 -2E99 - UPPS_ECOLI -
13 PsiBlast_PDB 91.8947%-141 - C6 -3SGV - UPPS_ECOLI -
76 HHSearch 91.6346%-137 - C6 -3SGV - UPPS_ECOLI -
35 PsiBlast_CBE 91.6347%-145 - C6 -2E98 5.4 UPPS_ECOLI
5 PsiBlast_PDB 91.5747%-130 - C6 -2E98 5.5 UPPS_ECOLI
33 PsiBlast_CBE 90.4747%-144 - C6 -2E9A 3.8 UPPS_ECOLI
69 PsiBlast_CBE 88.3135%-132 - C6 -2VG2 3.9 DPDS_MYCTU
61 PsiBlast_CBE 88.0135%-132 - C6 -4ONC 4.5 DPDS_MYCTU
67 PsiBlast_CBE 87.6435%-132 - C6 -2VG2 2.6 DPDS_MYCTU
56 PsiBlast_CBE 87.3839%-132 - C6 -5HXQ 3.9 ZFPS_SOLHA
78 HHSearch 87.1240%-137 - C6 -5HXP 3.3 ZFPS_SOLHA
68 PsiBlast_CBE 87.0835%-128 - C6 -2VG2 3.2 DPDS_MYCTU
70 PsiBlast_CBE 86.7035%-127 - C6 -2VG2 3.2 DPDS_MYCTU
58 PsiBlast_CBE 86.6339%-138 - C6 -5HXP 3.3 ZFPS_SOLHA
62 PsiBlast_CBE 86.5535%-132 - C6 -4ONC 3.9 DPDS_MYCTU
46 PsiBlast_CBE 86.4539% -90 - C6 -4Q9M 8.0 ISPT_STRR6
54 PsiBlast_CBE 86.2739%-131 - C6 -5HXT 4.2 ZFPS_SOLHA
53 PsiBlast_CBE 86.0039%-126 - C6 -5HXT 4.8 ZFPS_SOLHA
45 PsiBlast_CBE 85.8439% -89 - C6 -4Q9M 7.9 ISPT_STRR6
57 PsiBlast_CBE 85.2839%-128 - C6 -5HXP 5.3 ZFPS_SOLHA
82 HHSearch 84.9839% -87 - C6 -4Q9M 7.9 ISPT_STRR6
71 PsiBlast_CBE 69.3437% -64 - C6 -2DTN 4.0 ISPT_HELPY