@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMX5: (2017-11-11 )
MALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGARKYAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETGMAGEEDGVGAEGVLDHSQLLTSAEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHVALPNTHLVMHGSSSVPQEWLKVINEFGGNIGDTYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PH4_A_5(3C56)
ALF_HELPY
[Raw transfer]




TD4_A_3(3N9S)
?
[Raw transfer]




TD4_A_3(3N9S)
?
[Raw transfer]




2FP_A_2(3ELF)
ALF_MYCTU
[Raw transfer]




TD4_B_10(3N9S)
?
[Raw transfer]




PH4_B_6(3C56)
ALF_HELPY
[Raw transfer]




PGH_B_6(2ISV)
?
[Raw transfer]




CIT_A_3(5U7S)
?
[Raw transfer]




PGH_A_4(2ISW)
?
[Raw transfer]




PGH_A_4(2ISW)
?
[Raw transfer]




13P_A_5(2FJK)
ALF_THECA
[Raw transfer]




13P_A_5(2FJK)
ALF_THECA
[Raw transfer]




PGH_A_5(2ISV)
?
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




FMT_B_5(5U7S)
?
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_B_12(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_B_12(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_9(3C52)
ALF_HELPY
[Raw transfer]




13P_A_8(3Q94)
?
[Raw transfer]




1 PsiBlast_PDB 97.3899% -98 - C5 -5U7S 4.4 ?
21 PsiBlast_CBE 96.4399% -93 - C5 -5U7S 3.5 ?
40 HHSearch 95.0681% -81 - C5 -5U4N - ? -
2 PsiBlast_PDB 94.8380% -82 - C5 -5U4N - ? -
42 HHSearch 80.0749%-101 - C5 -2ISW 4.2 ?
5 PsiBlast_PDB 79.0346% -70 - C5 -2ISW 4.2 ?
23 PsiBlast_CBE 78.7646% -70 - C5 -2ISV 4.7 ?
4 PsiBlast_PDB 77.1046% -72 - C5 -2ISV 3.5 ?
3 PsiBlast_PDB 76.8647%-108 - C5 -3GAK - ? -
10 PsiBlast_PDB 76.1637% -88 - C5 -3C56 5.0 ALF_HELPY
12 PsiBlast_PDB 76.1037% -87 - C5 -3N9S 6.0 ?
45 HHSearch 75.8343% -94 - C5 -1RVG - ? -
30 PsiBlast_CBE 75.8237% -90 - C5 -3N9S 6.0 ?
9 PsiBlast_PDB 75.5237% -89 - C5 -3C52 4.0 ALF_HELPY
8 PsiBlast_PDB 75.1837% -95 - C5 -3C4U - ALF_HELPY -
13 PsiBlast_PDB 74.9840% -83 - C5 -2FJK 4.4 ALF_THECA
36 PsiBlast_CBE 74.8837% -89 - C5 -3C56 5.5 ALF_HELPY
43 HHSearch 74.3639% -46 - C5 -3N9S 6.0 ?
46 HHSearch 74.3542% -88 - C5 -2FJK 4.4 ALF_THECA
7 PsiBlast_PDB 74.3241% 1 - C5 -1RVG - ? -
39 PsiBlast_CBE 69.8233%-109 - C5 -1GVF 4.0 KBAY_ECOLI
15 PsiBlast_PDB 69.8233%-115 - C5 -1GVF 3.5 KBAY_ECOLI
47 HHSearch 68.8737%-107 - C5 -1GVF 4.1 KBAY_ECOLI
64 Fugue 63.2537% 26 * C5 *1GVF 3.5 KBAY_ECOLI