@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VND2: (2017-11-13 )
MFQHIPPYAGDPILSLMEQFNADTRSEKVNLSIGLYYNEDSIVPQLETIIEAQKRIEPKNGKTKLYLPMEGFKPYREAIQALLFGANSPAVKAGRAVTIQTLGGSGALKVGADFLKTYFPNSDVWVSQPTWDNHVAIFNGAGIKTHFYPYFDAETRGVDFDGMLSTLKTLPEQSIVLLHPCCHNPTGADLNPAQWDQVIAVLKDRNLIPFLDIAYQGFGDGMEEDAYAIRALDQAGLNFIVSNSFSKIFSLYGERVGGLTFVCDDAEAAQCTFGQLKATVRRIYSSPPTTGAWLVDEVLNDAELNQQWQGEVKEMRERIIKMRSILKDELTKALPDRDFSYLVNQKGMFSYTGLTAEQVDILREEYAIYLVRSGRICVAGLNMNNVYTVAKAMAEVLAKSVEAA

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3QP_A_15(3QPG)
AAT_ECOLI
[Raw transfer]




3QP_A_7(4DBC)
AAT_ECOLI
[Raw transfer]




PP3_C_3(1C9C)
AAT_ECOLI
[Raw transfer]




PLA_B_4(1ASL)
AAT_ECOLI
[Raw transfer]




PY6_C_3(1CQ8)
AAT_ECOLI
[Raw transfer]




PGU_C_3(1X28)
AAT_ECOLI
[Raw transfer]




PPD_A_3(1ARG)
AAT_ECOLI
[Raw transfer]




PY4_C_3(1CQ6)
AAT_ECOLI
[Raw transfer]




PY5_C_3(1CQ7)
AAT_ECOLI
[Raw transfer]




PLA_A_3(1ASL)
AAT_ECOLI
[Raw transfer]




PGU_D_4(1X28)
AAT_ECOLI
[Raw transfer]




PPD_B_4(1ARG)
AAT_ECOLI
[Raw transfer]




PMG_D_4(1X29)
AAT_ECOLI
[Raw transfer]




HCI_A_4(1AHX)
AAT_ECOLI
[Raw transfer]




PJ7_A_2(3PA9)
?
[Raw transfer]




AKG_A_4(1AIB)
AAT_ECOLI
[Raw transfer]




MAE_A_4(1AHY)
AAT_ECOLI
[Raw transfer]




MAE_B_6(1AHY)
AAT_ECOLI
[Raw transfer]




77E_A_2(5T4L)
AAT_ECOLI
[Raw transfer]




GUA_E_5(1AMS)
AAT_ECOLI
[Raw transfer]




PMP_A_11(4RKC)
?
[Raw transfer]




HCI_C_3(1TOI)
AAT_ECOLI
[Raw transfer]




PLP_A_4(3MEB)
?
[Raw transfer]




PMP_A_5(1AIC)
AAT_ECOLI
[Raw transfer]




PDG_C_3(1X2A)
AAT_ECOLI
[Raw transfer]




PMG_C_3(1X29)
AAT_ECOLI
[Raw transfer]




PMP_A_3(3PAA)
?
[Raw transfer]




PMP_B_16(4RKC)
?
[Raw transfer]




PMP_B_16(4RKC)
?
[Raw transfer]




PMP_C_3(1AMR)
AAT_ECOLI
[Raw transfer]




PMP_A_3(1AIA)
AAT_ECOLI
[Raw transfer]




PMP_C_3(1AMQ)
AAT_ECOLI
[Raw transfer]




PMP_A_3(3PA9)
?
[Raw transfer]




IVA_E_5(2D63)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ART)
AAT_ECOLI
[Raw transfer]




PJ7_A_2(3PAA)
?
[Raw transfer]




PMP_A_3(1AIB)
AAT_ECOLI
[Raw transfer]




PMP_B_5(1AIB)
AAT_ECOLI
[Raw transfer]




PMP_B_6(1AIC)
AAT_ECOLI
[Raw transfer]




PLP_E_5(1AAM)
AAT_ECOLI
[Raw transfer]




NPL_C_3(1ASC)
AAT_ECOLI
[Raw transfer]




PMP_B_4(1AIA)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1ASM)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1G4V)
AAT_ECOLI
[Raw transfer]




GOL_A_13(3PAA)
?
[Raw transfer]




PLP_A_3(1B4X)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D7Y)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1AHY)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1AHX)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1AHY)
AAT_ECOLI
[Raw transfer]




PLP_A_5(1ASN)
AAT_ECOLI
[Raw transfer]




EDO_A_9(4F5L)
AAT_ECOLI
[Raw transfer]




PLP_A_2(3K7Y)
?
[Raw transfer]




PLP_B_5(1AHX)
AAT_ECOLI
[Raw transfer]




PLP_E_5(1ASF)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ASA)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX7)
AAT_ECOLI
[Raw transfer]




PLP_B_6(1ASN)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1ASM)
AAT_ECOLI
[Raw transfer]




EDO_A_9(4F5L)
AAT_ECOLI
[Raw transfer]




PDG_D_4(1X2A)
AAT_ECOLI
[Raw transfer]




PLP_E_5(3AAT)
AAT_ECOLI
[Raw transfer]




PLP_A_4(1AHF)
AAT_ECOLI
[Raw transfer]




PLP_B_4(2AY1)
TYRB_PARDE
[Raw transfer]




PLP_B_6(1AHF)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2AY8)
TYRB_PARDE
[Raw transfer]




PMP_C_3(1AMS)
AAT_ECOLI
[Raw transfer]




PLP_A_3(5EAA)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX6)
AAT_ECOLI
[Raw transfer]




PLP_A_5(1AHE)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ASG)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1AAW)
AAT_ECOLI
[Raw transfer]




PLP_B_6(1AHE)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ARS)
AAT_ECOLI
[Raw transfer]




MPL_C_3(1ASD)
AAT_ECOLI
[Raw transfer]




NPL_C_3(1SPA)
AAT_ECOLI
[Raw transfer]




NOP_C_3(1ASE)
AAT_ECOLI
[Raw transfer]




EDO_A_4(4F4E)
?
[Raw transfer]




EDO_B_6(4F4E)
?
[Raw transfer]




PLP_A_3(2D63)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX8)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ASB)
AAT_ECOLI
[Raw transfer]




PMP_E_5(2AAT)
AAT_ECOLI
[Raw transfer]




CH3_E_5(1ART)
AAT_ECOLI
[Raw transfer]




2 PsiBlast_PDB 98.4365%-129 - C1 -3FSL - TYRB_ECOLI -
30 PsiBlast_CBE 97.0965%-129 - C1 -3FSL - TYRB_ECOLI -
29 PsiBlast_CBE 96.8565%-132 - C1 -3FSL - TYRB_ECOLI -
26 PsiBlast_CBE 96.8365%-132 - C1 -3FSL - TYRB_ECOLI -
28 PsiBlast_CBE 96.6865%-131 - C1 -3FSL - TYRB_ECOLI -
27 PsiBlast_CBE 95.0965%-132 - C1 -3FSL - TYRB_ECOLI -
5 PsiBlast_PDB 90.8152%-127 - C1 -4WD2 - ? -
22 PsiBlast_CBE 88.1265%-121 - C1 -3TAT - TYRB_ECOLI -
25 PsiBlast_CBE 87.4765%-121 - C1 -3TAT - TYRB_ECOLI -
1 PsiBlast_PDB 87.3765%-121 - C1 -3TAT - TYRB_ECOLI -
23 PsiBlast_CBE 87.2165%-121 - C1 -3TAT - TYRB_ECOLI -
24 PsiBlast_CBE 86.9365%-121 - C1 -3TAT - TYRB_ECOLI -
21 PsiBlast_CBE 86.8765%-121 - C1 -3TAT - TYRB_ECOLI -
13 PsiBlast_PDB 83.4143%-112 - C1 -1TOE - AAT_ECOLI -
45 PsiBlast_CBE 83.3242%-111 - C1 -3QPG 9.8 AAT_ECOLI
59 PsiBlast_CBE 82.9542%-108 - C1 -1ASN 4.4 AAT_ECOLI
16 PsiBlast_PDB 82.8443%-110 - C1 -4F5L 2.1 AAT_ECOLI
39 PsiBlast_CBE 82.6943%-114 - C1 -1AHY 3.6 AAT_ECOLI
9 PsiBlast_PDB 82.6543%-113 - C1 -1AHX 4.5 AAT_ECOLI
18 PsiBlast_PDB 82.6343%-110 - C1 -4F5I - AAT_ECOLI -
64 PsiBlast_CBE 82.6242%-116 - C1 -1ASE 3.2 AAT_ECOLI
14 PsiBlast_PDB 82.5843%-116 - C1 -1TOI 4.4 AAT_ECOLI
52 PsiBlast_CBE 82.3042%-110 - C1 -1X28 9.9 AAT_ECOLI
73 PsiBlast_CBE 82.2542%-111 - C1 -1AMQ 6.8 AAT_ECOLI
50 PsiBlast_CBE 82.2142%-109 - C1 -1X29 9.8 AAT_ECOLI
65 PsiBlast_CBE 82.1542%-114 - C1 -1ASD 4.1 AAT_ECOLI
40 PsiBlast_CBE 82.0643%-114 - C1 -1AHX 3.5 AAT_ECOLI
60 PsiBlast_CBE 82.0142%-111 - C1 -1ASM 4.7 AAT_ECOLI
99 PsiBlast_CBE 81.9041%-112 - C1 -1G4V 4.8 AAT_ECOLI
8 PsiBlast_PDB 81.7743%-111 - C1 -1AHY 4.0 AAT_ECOLI
71 PsiBlast_CBE 81.7242%-109 - C1 -1AMS 6.6 AAT_ECOLI
46 PsiBlast_CBE 81.7242%-109 - C1 -3PAA 7.7 ?
66 PsiBlast_CBE 81.6042%-113 - C1 -1ASA 4.4 AAT_ECOLI
61 PsiBlast_CBE 81.5542%-108 - C1 -1ASM 4.7 AAT_ECOLI
47 PsiBlast_CBE 81.5542%-109 - C1 -3PA9 7.8 ?
89 PsiBlast_CBE 81.5341%-115 - C1 -4DBC 10.1 AAT_ECOLI
55 PsiBlast_CBE 81.4942%-111 - C1 -1CQ7 9.5 AAT_ECOLI
93 PsiBlast_CBE 81.4841%-114 - C1 -1ASB 5.2 AAT_ECOLI
44 PsiBlast_CBE 81.4442%-107 - C1 -5T4L 5.7 AAT_ECOLI
72 PsiBlast_CBE 81.2842%-109 - C1 -1AMR 6.6 AAT_ECOLI
70 PsiBlast_CBE 81.1842%-108 - C1 -1ARG 8.8 AAT_ECOLI
54 PsiBlast_CBE 81.1842%-108 - C1 -1CQ8 9.5 AAT_ECOLI
53 PsiBlast_CBE 81.1142%-108 - C1 -1X28 9.8 AAT_ECOLI
67 PsiBlast_CBE 81.0742%-112 - C1 -1ART 9.6 AAT_ECOLI
12 PsiBlast_PDB 81.0643%-111 - C1 -1AHE 4.3 AAT_ECOLI
97 PsiBlast_CBE 81.0241%-106 - C1 -5EAA 4.5 AAT_ECOLI
94 PsiBlast_CBE 80.9541%-109 - C1 -1IX8 3.9 AAT_ECOLI
69 PsiBlast_CBE 80.9542%-110 - C1 -1ARG 9.2 AAT_ECOLI
68 PsiBlast_CBE 80.9542%-111 - C1 -1ARS 5.2 AAT_ECOLI
43 PsiBlast_CBE 80.9443%-111 - C1 -1AHE 4.7 AAT_ECOLI
74 PsiBlast_CBE 80.9342%-115 - C1 -1AAW 4.4 AAT_ECOLI
11 PsiBlast_PDB 80.9243%-110 - C1 -1AHF 4.1 AAT_ECOLI
75 PsiBlast_CBE 80.8542%-109 - C1 -1IX7 4.3 AAT_ECOLI
98 PsiBlast_CBE 80.6441%-111 - C1 -1B4X 4.5 AAT_ECOLI
77 PsiBlast_CBE 80.6141%-110 - C1 -1ASG 3.9 AAT_ECOLI
57 PsiBlast_CBE 80.5942%-110 - C1 -1C9C 8.4 AAT_ECOLI
85 PsiBlast_CBE 80.5741%-111 - C1 -1AIB 6.3 AAT_ECOLI
42 PsiBlast_CBE 80.5443%-116 - C1 -1AHF 4.9 AAT_ECOLI
63 PsiBlast_CBE 80.5042%-110 - C1 -1ASL 7.9 AAT_ECOLI
48 PsiBlast_CBE 80.3942%-108 - C1 -1X2A 10.3 AAT_ECOLI
91 PsiBlast_CBE 80.3441%-114 - C1 -1SPA 7.1 AAT_ECOLI
88 PsiBlast_CBE 80.2741%-110 - C1 -1AIA 6.8 AAT_ECOLI
56 PsiBlast_CBE 80.2642%-107 - C1 -1CQ6 7.4 AAT_ECOLI
83 PsiBlast_CBE 80.2341%-113 - C1 -1AIC 6.4 AAT_ECOLI
92 PsiBlast_CBE 80.2141%-111 - C1 -1ASC 6.4 AAT_ECOLI
76 PsiBlast_CBE 80.1242%-110 - C1 -1IX6 5.5 AAT_ECOLI
84 PsiBlast_CBE 80.1141%-114 - C1 -1AIC 7.1 AAT_ECOLI
49 PsiBlast_CBE 80.0442%-109 - C1 -1X2A 10.5 AAT_ECOLI
86 PsiBlast_CBE 80.0241%-110 - C1 -1AIB 6.1 AAT_ECOLI
58 PsiBlast_CBE 79.9942%-110 - C1 -1ASN 4.1 AAT_ECOLI
101 PsiBlast_CBE 79.9241%-109 - C1 -2D63 4.2 AAT_ECOLI
62 PsiBlast_CBE 79.9242%-110 - C1 -1ASL 7.1 AAT_ECOLI
78 PsiBlast_CBE 79.8641%-114 - C1 -1ASF 4.3 AAT_ECOLI
87 PsiBlast_CBE 79.4841%-110 - C1 -1AIA 6.3 AAT_ECOLI
3 PsiBlast_PDB 79.2653% -37 - C1 -4RKC 6.3 ?
51 PsiBlast_CBE 79.2342%-107 - C1 -1X29 9.9 AAT_ECOLI
7 PsiBlast_PDB 79.0652% -38 - C1 -4F4E 2.4 ?
100 PsiBlast_CBE 78.3241%-106 - C1 -2D7Y 4.1 AAT_ECOLI
38 PsiBlast_CBE 77.9853% -40 - C1 -4RKC 6.3 ?
96 PsiBlast_CBE 77.9341%-108 - C1 -3AAT 4.1 AAT_ECOLI
90 PsiBlast_CBE 74.4841% -96 - C1 -2AAT 4.4 AAT_ECOLI
95 PsiBlast_CBE 74.2441%-101 - C1 -1AAM 3.1 AAT_ECOLI
121 HHSearch 69.4052% -8 - C1 -4F4E 2.5 ?
112 HHSearch 68.3253% -1 - C1 -4RKC 6.3 ?
117 HHSearch 60.9738% -25 - C1 -2AY1 4.5 TYRB_PARDE
116 HHSearch 60.4743% 18 - C1 -4F5L 2.1 AAT_ECOLI
118 HHSearch 59.3638% -20 - C1 -2AY8 5.0 TYRB_PARDE
127 HHSearch 53.6034% -6 - C1 -3MEB 6.5 ?
113 HHSearch 51.0831% 3 - C1 -3K7Y 5.4 ?