@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VNK2: (2017-11-16 )
MRNSAMQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGAMAYTTVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYDKDIEAAIKAGIESFKATQTY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

QUE_N_(2JJ2)
ATPA_BOVIN
[Raw transfer]




139 HHSearch 96.6475% 0 - C- -3OAA - ATPA_ECOLI -
38 PsiBlast_CBE 83.7056% -89 - C5 -5HKK - ? -
148 HHSearch 83.6058% -88 * C5 *5IK2 - ? -
7 PsiBlast_PDB 83.3556% -89 - C5 -5HKK - ? -
125 PsiBlast_CBE 83.2157% -89 - C5 -5IK2 - ? -
149 HHSearch 83.0358% -85 - C5 -5IK2 - ? -
39 PsiBlast_CBE 82.7656% -90 - C5 -5HKK - ? -
124 PsiBlast_CBE 82.2857% -91 - C5 -5IK2 - ? -
123 PsiBlast_CBE 82.1057% -89 - C5 -5IK2 - ? -
1 PsiBlast_PDB 82.0974% -61 - C5 -5T4O - ATPA_ECOLI -
138 HHSearch 82.0474% -60 - C5 -5T4O - ATPA_ECOLI -
158 HHSearch 81.7156% 0 - C- -4B2Q - ATPA_YEAST -
34 PsiBlast_CBE 81.5274% -52 - C5 -5T4O - ATPA_ECOLI -
30 PsiBlast_CBE 81.3874% -55 - C5 -5T4Q - ATPA_ECOLI -
145 HHSearch 81.0554% -94 - C5 -1FX0 - ATPA_SPIOL -
2 PsiBlast_PDB 80.9474% -43 - C5 -5T4P - ATPA_ECOLI -
33 PsiBlast_CBE 80.7374% -50 - C5 -5T4O - ATPA_ECOLI -
31 PsiBlast_CBE 80.6474% -40 - C5 -5T4P - ATPA_ECOLI -
3 PsiBlast_PDB 80.5474% -55 - C5 -5T4Q - ATPA_ECOLI -
101 PsiBlast_CBE 79.7756% -13 - C5 -2JIZ - ATPA_BOVIN -
89 PsiBlast_CBE 78.6656% -13 - C5 -2JJ2 3.2 ATPA_BOVIN