@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VPA2: (2017-11-20 )
MSYSNIPAGKDAPNDIYVIIEIPANAAPIKYEIDKDSDALFVDRFMGTAMFYPANYGYVPNTLSEDGDPLDVLVVTPHPVAAGSVIRCRPVGKLNMEDDGGIDAKLIAVPHEKLSPLYKDVQEYTDLPPLLISQVEHFFSHYKDLEPGKWVKISGWEGADVAKAEVLKAIEAAKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

12P_A_4(4XEL)
IPYR_PSEAE
[Raw transfer]




12P_A_4(4XEL)
IPYR_PSEAE
[Raw transfer]




11X_A_2(3EJ0)
?
[Raw transfer]




1 PsiBlast_PDB 95.3974% -92 - C5 -4XEL 2.9 IPYR_PSEAE
21 PsiBlast_CBE 94.4974% -91 - C5 -4XEL 2.6 IPYR_PSEAE
5 PsiBlast_PDB 92.3067% -90 - C5 -1JFD - IPYR_ECOLI -
13 PsiBlast_PDB 91.7767% -90 - C5 -1I40 - IPYR_ECOLI -
9 PsiBlast_PDB 91.7167% -88 - C5 -1MJX - IPYR_ECOLI -
3 PsiBlast_PDB 91.5267% -99 - C5 -2EIP - IPYR_ECOLI -
8 PsiBlast_PDB 91.3867% -84 - C5 -1MJW - IPYR_ECOLI -
38 PsiBlast_CBE 90.8353% -96 - C5 -3SW5 - ? -
12 PsiBlast_PDB 90.5467% -82 - C5 -1I6T - IPYR_ECOLI -
14 PsiBlast_PDB 90.4667% -84 - C5 -2AU6 - IPYR_ECOLI -
16 PsiBlast_PDB 90.4567% -84 - C5 -2AU9 - IPYR_ECOLI -
39 PsiBlast_CBE 90.4253%-100 - C5 -3SW5 - ? -
20 PsiBlast_PDB 90.4266% -81 - C5 -1MJY - IPYR_ECOLI -
17 PsiBlast_PDB 90.2467% -81 - C5 -2AUU - IPYR_ECOLI -
11 PsiBlast_PDB 90.2467% -87 - C5 -1OBW - IPYR_ECOLI -
6 PsiBlast_PDB 90.2467% -93 - C5 -1FAJ - IPYR_ECOLI -
7 PsiBlast_PDB 90.1467% -88 - C5 -1INO - IPYR_ECOLI -
36 PsiBlast_CBE 89.9553% -94 - C5 -3SW5 - ? -
33 PsiBlast_CBE 89.7855% -86 - C5 -3EJ2 - ? -
15 PsiBlast_PDB 89.7467% -83 - C5 -2AU8 - IPYR_ECOLI -