@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VPM7: (2017-11-22 )
MSADTQHFTGTDQYIATDSLKLAVKAARALQKPLLVKGEPGTGKTLLAEQVAESLGLKLITWHIKSTTKAQQGLYEYDAVSRLRDSQLGDDRVYDIKNYIKPGKLWEAFTSEERCVLLIDEIDKADIEFPNDLLHELDKMSFYVYETGETITATQRPIVIITSNNEKELPDAFLRRCFFHYIEFPDEATMREIISVHFPNISVTLVNEALQVFFKLREIPNLKKPPSTSELIDWLSLLMADDMPEDVLRNRDTSKAIPPLYGALIKNEQDVQLLERLAFMSRR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_7(4WW0)
FTSH_AQUAE
[Raw transfer]




10 PsiBlast_PDB 79.0824% 0 - C- -5MPA - PRS10_YEAST -
9 PsiBlast_PDB 79.0824% 0 - C- -5MP9 - PRS10_YEAST (first) -
123 HHSearch 74.8425% 0 - C- -5MPA - -
145 Fugue 72.3120% 29 - C2 -3VKG - ? -
140 Fugue 70.3119% -59 - C4 -5C3C - ? -
110 HHSearch 67.4722% -49 - C4 -5C3C - ? -
111 HHSearch 66.7522% -73 - C4 -5C3C - ? -
16 PsiBlast_PDB 65.9725% - - C4 -5T0G - PRS10_HUMAN -
17 PsiBlast_PDB 65.6925% - - C4 -5T0H - PRS10_HUMAN -
141 Fugue 65.1020% 46 - C2 -5E7P - ? -
3 PsiBlast_PDB 64.9927% -48 - C4 -4WW0 - FTSH_AQUAE -
18 PsiBlast_PDB 64.8225% - - C4 -5T0I - PRS10_HUMAN -
13 PsiBlast_PDB 64.7224% -59 - C4 -2R62 - FTSH_HELPY -
19 PsiBlast_PDB 64.7125% - - C4 -5T0J - PRS10_HUMAN -
14 PsiBlast_PDB 64.1024% -70 - C4 -2R65 - FTSH_HELPY -
4 PsiBlast_PDB 63.4127% -39 - C4 -4Z8X - FTSH_AQUAE -
6 PsiBlast_PDB 63.0824% -65 - C4 -4CR3 - PRS10_YEAST -
8 PsiBlast_PDB 63.0524% -65 - C4 -5A5B - PRS10_YEAST -
7 PsiBlast_PDB 62.9924% -53 - C4 -4CR4 - PRS10_YEAST -
142 Fugue 62.8317% 40 * C2 *1E32 - TERA_MOUSE -
121 HHSearch 62.7232% -45 - C4 -4WW0 6.6 FTSH_AQUAE