@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQ33: (2017-11-24 )
MPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_2(3BAF)
AROK_MYCTU
[Raw transfer]




ADP_B_6(4BQS)
AROK_MYCTU
[Raw transfer]




ACP_B_2(1ZYU)
AROK_MYCTU
[Raw transfer]




ATP_A_2(2IYW)
AROK_MYCTU
[Raw transfer]




ADP_B_7(2SHK)
AROL_DICCH
[Raw transfer]




SKM_A_2(4Y0A)
?
[Raw transfer]




TLA_B_9(3N2E)
AROK_HELPY
[Raw transfer]




S3P_A_2(2IYY)
AROK_MYCTU
[Raw transfer]




SKM_C_3(1ZUI)
AROK_HELPY
[Raw transfer]




S3P_A_2(2IYZ)
AROK_MYCTU
[Raw transfer]




PEG_A_6(3VAA)
AROK_BACTN
[Raw transfer]




PEG_A_6(3VAA)
AROK_BACTN
[Raw transfer]




SKM_A_6(1U8A)
AROK_MYCTU
[Raw transfer]




SKM_A_4(2DFN)
AROK_MYCTU
[Raw transfer]




SKM_B_4(2IYR)
AROK_MYCTU
[Raw transfer]




SKM_C_3(1ZYU)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYQ)
AROK_MYCTU
[Raw transfer]




K2Q_B_7(4BQS)
AROK_MYCTU
[Raw transfer]




OSA_A_4(3N2E)
AROK_HELPY
[Raw transfer]




SKM_A_7(2G1K)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYX)
AROK_MYCTU
[Raw transfer]




K2Q_C_9(4BQS)
AROK_MYCTU
[Raw transfer]




DHK_A_6(1WE2)
AROK_MYCTU
[Raw transfer]




K2Q_A_5(4BQS)
AROK_MYCTU
[Raw transfer]




SKM_A_3(3BAF)
AROK_MYCTU
[Raw transfer]




SKM_A_3(2IYR)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYS)
AROK_MYCTU
[Raw transfer]




BME_B_7(3VAA)
AROK_BACTN
[Raw transfer]




TLA_A_5(3N2E)
AROK_HELPY
[Raw transfer]




TLA_A_5(3N2E)
AROK_HELPY
[Raw transfer]




BME_C_10(3VAA)
AROK_BACTN
[Raw transfer]




TLA_B_8(3N2E)
AROK_HELPY
[Raw transfer]




206 HHSearch 85.87100% -87 - C2 -4Y0A 4.3 ?
1 PsiBlast_PDB 85.87100% -87 - C2 -4Y0A - ? -
211 HHSearch 61.3144% -39 - C2 -3TRF - AROK_COXBU -
228 Fugue 59.1436%-120 * C2 *1SHK - AROL_DICCH -
213 HHSearch 58.9834%-111 - C2 -1E6C - AROL_DICCH -
207 HHSearch 58.4351% -43 - C2 -1KAG - AROK_ECOLI -
212 HHSearch 58.1437% -98 - C2 -2IYV - AROK_MYCTU -
3 PsiBlast_PDB 57.8644% -34 - C2 -3TRF - AROK_COXBU -
2 PsiBlast_PDB 57.7553% -48 - C2 -1KAG - AROK_ECOLI -
227 Fugue 57.3650% -70 - C2 -1KAG - AROK_ECOLI -
210 HHSearch 56.7244% -36 - C2 -3TRF - AROK_COXBU -
217 HHSearch 56.1630% -92 - C2 -1VIA - ? -
209 HHSearch 55.8635% -96 - C2 -2PT5 - AROK_AQUAE -
214 HHSearch 54.7832% -73 - C2 -3VAA 2.1 AROK_BACTN
215 HHSearch 53.2032% -82 - C2 -3VAA - AROK_BACTN -
24 PsiBlast_CBE 53.0638%-125 - C2 -1E6C - AROL_DICCH -
47 PsiBlast_CBE 52.4532% -67 - C2 -3N2E 3.0 AROK_HELPY
6 PsiBlast_PDB 52.1438%-120 - C2 -1E6C - AROL_DICCH -
16 PsiBlast_PDB 51.6640% -85 - C2 -2IYY 3.7 AROK_MYCTU
48 PsiBlast_CBE 51.2532% -53 - C2 -3N2E 5.3 AROK_HELPY
29 PsiBlast_CBE 51.1440% -90 - C2 -3BAF 6.5 AROK_MYCTU
208 HHSearch 51.1332% -49 - C2 -3N2E 3.0 AROK_HELPY
15 PsiBlast_PDB 51.1340% -85 - C2 -2IYX 3.6 AROK_MYCTU
17 PsiBlast_PDB 50.5840% -89 - C2 -2IYZ 4.0 AROK_MYCTU
22 PsiBlast_CBE 50.4639% -96 - C2 -2SHK 4.0 AROL_DICCH
30 PsiBlast_CBE 50.2940% -86 - C2 -2G1K 3.4 AROK_MYCTU
26 PsiBlast_CBE 49.8840% -81 - C2 -4BQS 4.5 AROK_MYCTU
27 PsiBlast_CBE 49.5440% -82 - C2 -4BQS 6.5 AROK_MYCTU
38 PsiBlast_CBE 48.9640% -80 - C2 -1ZYU 5.7 AROK_MYCTU
28 PsiBlast_CBE 48.9440% -81 - C2 -4BQS 4.4 AROK_MYCTU
8 PsiBlast_PDB 48.7240% -81 - C2 -2IYQ 4.1 AROK_MYCTU
39 PsiBlast_CBE 48.4440% -74 - C2 -1WE2 3.9 AROK_MYCTU
46 PsiBlast_CBE 47.9732% -22 - C2 -1ZUI 5.4 AROK_HELPY
20 PsiBlast_PDB 47.5440% -85 - C2 -1U8A 3.5 AROK_MYCTU
37 PsiBlast_CBE 47.5340% -74 - C2 -2DFN 3.3 AROK_MYCTU
10 PsiBlast_PDB 47.4540% -82 - C2 -2IYS 2.4 AROK_MYCTU
9 PsiBlast_PDB 47.0640% -80 - C2 -2IYR 2.9 AROK_MYCTU
25 PsiBlast_CBE 46.0540% -80 - C2 -2IYR 4.2 AROK_MYCTU
42 PsiBlast_CBE 45.6035% -54 - C2 -3VAA 2.1 AROK_BACTN