@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQ53: (2017-11-25 )
MEIVLANPRGFCAGVDRAIAIVNRALECFNPPIYVRHEVVHNKFVVDDLRQRGAVFVDELDQVPDDSIVIFSAHGVSKAVQQEAERRGLKVFDATCPLVTKVHIEVTKYAREGTEAILIGHEGHPEVEGTMGQYDKLKGGDIYLVEDEADVAALEVRHPEKLAFVTQTTLSIDDTAKVIDALRAKFPNIQGPRKDDICYATQNRQDAVRDLAEKCDVVLVVGSPNSSNSNRLRELAERMGKAAYLVDNADQLEQSWFNDTCKIGVTAGASAPEILIKQVIQRLQDWGAQAPKELEGREENITFSLPKELRIHVTQA

Atome Classification :

(63 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2E4_A_4(4MUX)
?
[Raw transfer]




2E4_B_6(4MUX)
?
[Raw transfer]




2E5_B_6(4MUY)
?
[Raw transfer]




0K2_B_7(3UWM)
ISPH_ECOLI
[Raw transfer]




2E6_B_6(4MV0)
?
[Raw transfer]




2E6_A_4(4MV0)
?
[Raw transfer]




0CJ_B_6(3UTD)
ISPH_ECOLI
[Raw transfer]




0O3_B_6(4EB3)
ISPH_ECOLI
[Raw transfer]




H6P_A_4(3SZL)
ISPH_ECOLI
[Raw transfer]




0JX_B_6(3UTC)
ISPH_ECOLI
[Raw transfer]




2E7_A_4(4MV5)
?
[Raw transfer]




H6P_B_6(3SZL)
ISPH_ECOLI
[Raw transfer]




0CN_B_6(3UV7)
ISPH_ECOLI
[Raw transfer]




10E_B_6(3ZGL)
ISPH_ECOLI
[Raw transfer]




2E7_B_6(4MV5)
?
[Raw transfer]




10G_B_6(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_6(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4MUX)
?
[Raw transfer]




SF4_B_5(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4MUX)
?
[Raw transfer]




SF4_A_3(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_4(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE9)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MUY)
?
[Raw transfer]




F3S_A_3(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MUY)
?
[Raw transfer]




F3S_A_3(4MV0)
?
[Raw transfer]




F3S_A_3(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_B_9(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MV0)
?
[Raw transfer]




F3S_A_3(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_A_4(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_6(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_2(4N7B)
?
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_2(4N7B)
?
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




29 PsiBlast_CBE 93.2064%-107 - C7 -4MV5 6.2 ?
28 PsiBlast_CBE 93.1864%-105 - C7 -3F7T 3.3 ISPH_ECOLI
34 PsiBlast_CBE 93.1264%-105 - C7 -3UWM 4.6 ISPH_ECOLI
33 PsiBlast_CBE 93.0764%-109 - C7 -4EB3 5.0 ISPH_ECOLI
31 PsiBlast_CBE 93.0464%-109 - C7 -4MUY 5.7 ?
35 PsiBlast_CBE 93.0264%-108 - C7 -3UV7 5.3 ISPH_ECOLI
38 PsiBlast_CBE 92.8064%-107 - C7 -3UTD 5.8 ISPH_ECOLI
11 PsiBlast_PDB 92.5464%-107 - C7 -4MV0 5.5 ?
24 PsiBlast_CBE 92.5164%-105 - C7 -3ZGN 5.8 ISPH_ECOLI
25 PsiBlast_CBE 92.4064%-104 - C7 -3ZGL 5.6 ISPH_ECOLI
52 PsiBlast_CBE 92.3664%-105 - C7 -3SZU 3.8 ISPH_ECOLI
13 PsiBlast_PDB 92.3264%-107 - C7 -4MV5 6.2 ?
7 PsiBlast_PDB 92.3064%-102 - C7 -3SZL 5.6 ISPH_ECOLI
12 PsiBlast_PDB 92.2864%-105 - C7 -4MUX 5.6 ?
27 PsiBlast_CBE 92.2764%-106 - C7 -3SZL 5.8 ISPH_ECOLI
39 PsiBlast_CBE 92.2364%-106 - C7 -3UTC 5.1 ISPH_ECOLI
44 PsiBlast_CBE 92.2064%-103 - C7 -3KEL 3.6 ISPH_ECOLI
32 PsiBlast_CBE 92.1964%-108 - C7 -4MUX 5.5 ?
30 PsiBlast_CBE 92.1564%-107 - C7 -4MV0 5.8 ?
10 PsiBlast_PDB 92.0464%-105 - C7 -4MUY 3.8 ?
40 PsiBlast_CBE 92.0264%-105 - C7 -3URK 3.9 ISPH_ECOLI
50 PsiBlast_CBE 91.9864%-100 - C7 -3KE8 3.8 ISPH_ECOLI
20 PsiBlast_PDB 91.9864%-104 - C7 -3UWM 3.8 ISPH_ECOLI
26 PsiBlast_CBE 91.9664%-106 - C7 -3SZO 3.8 ISPH_ECOLI
22 PsiBlast_CBE 91.9164%-108 - C7 -4H4D 3.8 ISPH_ECOLI
9 PsiBlast_PDB 91.9164%-105 - C7 -4EB3 3.9 ISPH_ECOLI
37 PsiBlast_CBE 91.8964%-105 - C7 -3UV3 3.9 ISPH_ECOLI
1 PsiBlast_PDB 91.8864%-105 - C7 -4H4C 3.7 ISPH_ECOLI
46 PsiBlast_CBE 91.8564%-105 - C7 -3KEF 3.6 ISPH_ECOLI
60 HHSearch 91.8464%-108 - C7 -4H4D 3.8 ISPH_ECOLI
41 PsiBlast_CBE 91.8364%-104 - C7 -3KEM 3.5 ISPH_ECOLI
21 PsiBlast_CBE 91.8364%-105 - C7 -4H4E 3.8 ISPH_ECOLI
15 PsiBlast_PDB 91.8364%-104 - C7 -3UTC 3.8 ISPH_ECOLI
51 PsiBlast_CBE 91.8064%-105 - C7 -3SZU 3.8 ISPH_ECOLI
19 PsiBlast_PDB 91.7964%-102 - C7 -3UV7 3.9 ISPH_ECOLI
14 PsiBlast_PDB 91.7664%-105 - C7 -3URK 3.9 ISPH_ECOLI
48 PsiBlast_CBE 91.6964%-106 - C7 -3KE9 3.8 ISPH_ECOLI
5 PsiBlast_PDB 91.6764%-104 - C7 -3ZGN 3.7 ISPH_ECOLI
54 PsiBlast_CBE 91.5464%-107 - C7 -3T0F 3.8 ISPH_ECOLI
23 PsiBlast_CBE 91.5264%-104 - C7 -4H4C 3.9 ISPH_ECOLI
6 PsiBlast_PDB 91.5164% -99 - C7 -3F7T 3.4 ISPH_ECOLI
45 PsiBlast_CBE 91.4864%-106 - C7 -3KEF 3.5 ISPH_ECOLI
36 PsiBlast_CBE 91.4764%-105 - C7 -3UV6 3.8 ISPH_ECOLI
8 PsiBlast_PDB 91.4764%-100 - C7 -3SZO 3.8 ISPH_ECOLI
49 PsiBlast_CBE 91.4664%-105 - C7 -3KE8 3.8 ISPH_ECOLI
17 PsiBlast_PDB 91.4564%-101 - C7 -3UV3 3.8 ISPH_ECOLI
43 PsiBlast_CBE 91.4364%-106 - C7 -3KEL 3.6 ISPH_ECOLI
18 PsiBlast_PDB 91.3764%-103 - C7 -3UV6 3.9 ISPH_ECOLI
16 PsiBlast_PDB 91.3764%-101 - C7 -3UTD 3.8 ISPH_ECOLI
2 PsiBlast_PDB 91.3564%-102 - C7 -4H4D 3.8 ISPH_ECOLI
3 PsiBlast_PDB 91.3464%-104 - C7 -4H4E 3.8 ISPH_ECOLI
55 PsiBlast_CBE 91.2464%-107 - C7 -3T0G 3.8 ISPH_ECOLI
56 PsiBlast_CBE 91.1264%-107 - C7 -3T0G 3.8 ISPH_ECOLI
47 PsiBlast_CBE 91.1064%-104 - C7 -3KE9 3.8 ISPH_ECOLI
42 PsiBlast_CBE 91.0864%-104 - C7 -3KEM 3.6 ISPH_ECOLI
4 PsiBlast_PDB 91.0264%-101 - C7 -3ZGL 3.8 ISPH_ECOLI
53 PsiBlast_CBE 89.9964%-118 - C7 -3T0F 3.8 ISPH_ECOLI
61 HHSearch 76.1740%-103 - C7 -4N7B 3.8 ?
57 PsiBlast_CBE 75.0440%-106 - C7 -4N7B 3.8 ?
62 HHSearch 72.3331%-122 - C7 -3DNF 3.7 ISPH_AQUAE
58 PsiBlast_CBE 71.2532%-117 - C7 -3DNF 3.7 ISPH_AQUAE
59 PsiBlast_CBE 70.1232%-118 - C7 -3DNF 3.7 ISPH_AQUAE
81 Fugue 58.0132% -8 - C7 -3DNF 3.7 ISPH_AQUAE