@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQ58: (2017-11-25 )
MFFAVITLFPEMFEAITAYGISGRAAKRDIVQVTCINPRDFAEGSYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASQAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVMSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPELIEQVTLTKQQKKWLSDEQG

Atome Classification :

(63 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_A_3(4H3Y)
TRMD_PARP8
[Raw transfer]




4GX_A_2(4YQI)
TRMD_HAEIN
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




SFG_A_2(4YVH)
TRMD_HAEIN
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_PARP8
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_PARP8
[Raw transfer]




SFG_B_5(4YVI)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVK)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVI)
TRMD_HAEIN
[Raw transfer]




4H7_A_2(4YQQ)
TRMD_HAEIN
[Raw transfer]




SAH_B_6(4H3Z)
TRMD_PARP8
[Raw transfer]




SAH_B_6(4H3Z)
TRMD_PARP8
[Raw transfer]




SFG_B_5(4YVJ)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




SFG_A_4(4YVJ)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




4GT_A_2(4YQJ)
TRMD_HAEIN
[Raw transfer]




4G0_A_2(4YQ5)
TRMD_HAEIN
[Raw transfer]




58G_A_2(5D9F)
TRMD_HAEIN
[Raw transfer]




ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




4GY_A_2(4YQG)
TRMD_HAEIN
[Raw transfer]




4HQ_A_2(4YQR)
TRMD_HAEIN
[Raw transfer]




SFG_B_5(4YVK)
TRMD_HAEIN
[Raw transfer]




4G3_A_2(4YQ4)
TRMD_HAEIN
[Raw transfer]




4H4_A_2(4YQL)
TRMD_HAEIN
[Raw transfer]




4GM_A_2(4YQB)
TRMD_HAEIN
[Raw transfer]




4FD_A_2(4YPW)
TRMD_HAEIN
[Raw transfer]




4G4_A_2(4YQ7)
TRMD_HAEIN
[Raw transfer]




4GN_A_2(4YQA)
TRMD_HAEIN
[Raw transfer]




4H1_A_2(4YQO)
TRMD_HAEIN
[Raw transfer]




4FM_A_2(4YQ0)
TRMD_HAEIN
[Raw transfer]




4H8_A_2(4YQT)
TRMD_HAEIN
[Raw transfer]




4H6_A_2(4YQP)
TRMD_HAEIN
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




4H3_A_2(4YQN)
TRMD_HAEIN
[Raw transfer]




4GS_A_2(4YQK)
TRMD_HAEIN
[Raw transfer]




EFW_A_2(4YQC)
TRMD_HAEIN
[Raw transfer]




4FX_A_2(4YQ6)
TRMD_HAEIN
[Raw transfer]




4FV_A_2(4YQ8)
TRMD_HAEIN
[Raw transfer]




4GZ_A_2(4YQD)
TRMD_HAEIN
[Raw transfer]




4GZ_A_2(4YQD)
TRMD_HAEIN
[Raw transfer]




4GO_A_2(4YQ9)
TRMD_HAEIN
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




4H9_A_2(4YQS)
TRMD_HAEIN
[Raw transfer]




4G1_A_2(4YQ3)
TRMD_HAEIN
[Raw transfer]




4FN_A_2(4YQ1)
TRMD_HAEIN
[Raw transfer]




4FG_A_2(4YPX)
TRMD_HAEIN
[Raw transfer]




EFY_A_2(4YQ2)
TRMD_HAEIN
[Raw transfer]




4FL_A_2(4YPZ)
TRMD_HAEIN
[Raw transfer]




4F9_A_2(4YPY)
TRMD_HAEIN
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




EDO_A_3(3QUV)
?
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




53 PsiBlast_CBE 96.0852%-170 - C6 -4H3Y 7.0 TRMD_PARP8
51 PsiBlast_CBE 94.3352%-166 - C6 -4H3Z 7.4 TRMD_PARP8
52 PsiBlast_CBE 94.0952%-166 - C6 -4H3Y - TRMD_PARP8 -
36 PsiBlast_CBE 93.4253%-169 - C6 -4MCC 6.6 TRMD_HAEIN
3 PsiBlast_PDB 93.2853%-166 - C6 -1UAL 7.0 TRMD_HAEIN
41 PsiBlast_CBE 92.9453%-155 - C6 -4YVK 8.0 TRMD_HAEIN
40 PsiBlast_CBE 92.7153%-153 - C6 -4YVK 6.5 TRMD_HAEIN
30 PsiBlast_CBE 92.6253%-167 - C6 -4YQK 4.5 TRMD_HAEIN
38 PsiBlast_CBE 92.5553%-156 - C6 -4MCB 7.0 TRMD_HAEIN
2 PsiBlast_PDB 92.4153%-164 - C6 -1UAK - TRMD_HAEIN -
35 PsiBlast_CBE 92.3353%-163 - C6 -4MCD 5.9 TRMD_HAEIN
60 HHSearch 92.2852%-164 - C6 -4H3Z 7.4 TRMD_PARP8
4 PsiBlast_PDB 92.2853%-151 - C6 -1UAM 7.5 TRMD_HAEIN
23 PsiBlast_CBE 92.2753%-162 - C6 -4YQS 5.9 TRMD_HAEIN
43 PsiBlast_CBE 92.2153%-154 - C6 -4YVJ 7.9 TRMD_HAEIN
58 HHSearch 92.1655%-156 - C6 -4MCB 7.0 TRMD_HAEIN
1 PsiBlast_PDB 92.0753%-167 - C6 -1UAJ - TRMD_HAEIN -
20 PsiBlast_PDB 92.0453%-166 - C6 -4YQC 6.1 TRMD_HAEIN
22 PsiBlast_CBE 92.0253%-164 - C6 -4YQT 5.7 TRMD_HAEIN
59 HHSearch 92.0155%-158 - C6 -4YQD 8.3 TRMD_HAEIN
34 PsiBlast_CBE 92.0053%-163 - C6 -4YQ8 5.3 TRMD_HAEIN
18 PsiBlast_PDB 91.9553%-162 - C6 -4YQA 5.9 TRMD_HAEIN
31 PsiBlast_CBE 91.9153%-166 - C6 -4YQJ 5.4 TRMD_HAEIN
26 PsiBlast_CBE 91.9053%-165 - C6 -4YQP 5.4 TRMD_HAEIN
42 PsiBlast_CBE 91.8853%-155 - C6 -4YVJ 6.0 TRMD_HAEIN
32 PsiBlast_CBE 91.8653%-166 - C6 -4YQI 6.6 TRMD_HAEIN
25 PsiBlast_CBE 91.8653%-166 - C6 -4YQQ 6.7 TRMD_HAEIN
9 PsiBlast_PDB 91.7853%-168 - C6 -4YQ0 5.7 TRMD_HAEIN
48 PsiBlast_CBE 91.7753%-157 - C6 -4YQD 8.3 TRMD_HAEIN
45 PsiBlast_CBE 91.7453%-162 - C6 -4YVI 7.7 TRMD_HAEIN
6 PsiBlast_PDB 91.6953%-163 - C6 -4YPX 4.5 TRMD_HAEIN
50 PsiBlast_CBE 91.5852%-165 - C6 -4H3Z 6.8 TRMD_PARP8
49 PsiBlast_CBE 91.5153%-168 - C6 -3AXZ 6.1 TRMD_HAEIN
27 PsiBlast_CBE 91.4753%-162 - C6 -4YQO 6.2 TRMD_HAEIN
13 PsiBlast_PDB 91.4753%-155 - C6 -4YQ4 6.1 TRMD_HAEIN
8 PsiBlast_PDB 91.4453%-163 - C6 -4YPZ 4.5 TRMD_HAEIN
5 PsiBlast_PDB 91.3653%-166 - C6 -4YPW 5.5 TRMD_HAEIN
7 PsiBlast_PDB 91.3553%-159 - C6 -4YPY 4.9 TRMD_HAEIN
33 PsiBlast_CBE 91.3453%-165 - C6 -4YQG 5.2 TRMD_HAEIN
15 PsiBlast_PDB 91.3453%-162 - C6 -4YQ6 6.7 TRMD_HAEIN
10 PsiBlast_PDB 91.2653%-161 - C6 -4YQ1 9.4 TRMD_HAEIN
44 PsiBlast_CBE 91.1253%-153 - C6 -4YVI 7.8 TRMD_HAEIN
54 PsiBlast_CBE 91.0051%-166 - C6 -1P9P 7.1 TRMD_ECOLI
28 PsiBlast_CBE 90.9353%-166 - C6 -4YQN 5.0 TRMD_HAEIN
24 PsiBlast_CBE 90.8053%-160 - C6 -4YQR 5.7 TRMD_HAEIN
17 PsiBlast_PDB 90.7653%-160 - C6 -4YQ9 6.1 TRMD_HAEIN
16 PsiBlast_PDB 90.7053%-162 - C6 -4YQ7 6.2 TRMD_HAEIN
19 PsiBlast_PDB 90.6453%-158 - C6 -4YQB 6.4 TRMD_HAEIN
12 PsiBlast_PDB 90.6253%-162 - C6 -4YQ3 8.4 TRMD_HAEIN
21 PsiBlast_CBE 90.6153%-160 - C6 -5D9F 6.7 TRMD_HAEIN
14 PsiBlast_PDB 90.5853%-161 - C6 -4YQ5 7.0 TRMD_HAEIN
29 PsiBlast_CBE 90.1653%-161 - C6 -4YQL 4.7 TRMD_HAEIN
46 PsiBlast_CBE 90.1553%-160 - C6 -4YVH 7.8 TRMD_HAEIN
11 PsiBlast_PDB 90.1253%-158 - C6 -4YQ2 8.9 TRMD_HAEIN
61 HHSearch 89.6552%-162 - C6 -4H3Z 6.8 TRMD_PARP8
39 PsiBlast_CBE 86.6753%-172 - C6 -4MCB 6.9 TRMD_HAEIN
37 PsiBlast_CBE 84.7753%-173 - C6 -4MCC 6.6 TRMD_HAEIN
81 Fugue 82.7855% 26 * C6 *1UAL 7.0 TRMD_HAEIN
65 HHSearch 80.2940%-173 - C6 -4IG6 7.7 TRMD_ANAPZ
55 PsiBlast_CBE 80.2639%-169 - C6 -4IG6 7.7 TRMD_ANAPZ
57 PsiBlast_CBE 78.9836%-162 - C6 -3QUV 3.1 ?
56 PsiBlast_CBE 75.9536%-145 - C6 -3QUV 2.9 ?
67 HHSearch 74.8938%-144 - C6 -3QUV 2.9 ?