@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VR02: (2017-11-30 )
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICISVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHAVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI

Atome Classification :

(82 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

Y16_A_2(3PKB)
MAP12_MYCTU
[Raw transfer]




Y16_A_2(3PKB)
MAP12_MYCTU
[Raw transfer]




Y16_A_4(4FLI)
MAP11_HUMAN
[Raw transfer]




IKY_A_5(4A6V)
?
[Raw transfer]




Y10_A_4(4FLK)
MAP11_HUMAN
[Raw transfer]




Y10_A_2(3PKE)
MAP12_MYCTU
[Raw transfer]




Y10_A_2(3PKE)
MAP12_MYCTU
[Raw transfer]




5C1_A_3(4A6W)
?
[Raw transfer]




W29_A_4(3D27)
MAP1_ECOLI
[Raw transfer]




NLP_B_10(2GU5)
MAP1_ECOLI
[Raw transfer]




NLP_B_10(2GU6)
MAP1_ECOLI
[Raw transfer]




NLP_A_9(2GU6)
MAP1_ECOLI
[Raw transfer]




Y02_A_4(3PKA)
MAP12_MYCTU
[Raw transfer]




NLP_B_10(2GU4)
MAP1_ECOLI
[Raw transfer]




NLP_A_5(1C27)
MAP1_ECOLI
[Raw transfer]




YE7_A_4(2P98)
MAP1_ECOLI
[Raw transfer]




Y10_A_4(3PKD)
MAP12_MYCTU
[Raw transfer]




MPJ_A_5(1C24)
MAP1_ECOLI
[Raw transfer]




IKY_B_7(4A6V)
?
[Raw transfer]




U15_A_5(2GG8)
MAP1_ECOLI
[Raw transfer]




Q07_A_5(4U69)
MAP11_HUMAN
[Raw transfer]




B23_A_5(2Q92)
MAP1_ECOLI
[Raw transfer]




FC2_A_5(2EVM)
MAP1_ECOLI
[Raw transfer]




B21_A_5(2Q93)
MAP1_ECOLI
[Raw transfer]




U17_A_5(2GGB)
MAP1_ECOLI
[Raw transfer]




A18_A_5(2Q96)
MAP1_ECOLI
[Raw transfer]




NLP_A_9(2GU5)
MAP1_ECOLI
[Raw transfer]




FCD_A_5(1XNZ)
MAP1_ECOLI
[Raw transfer]




A05_A_5(2Q95)
MAP1_ECOLI
[Raw transfer]




A05_A_5(2Q95)
MAP1_ECOLI
[Raw transfer]




GOL_A_6(4U76)
MAP11_HUMAN
[Raw transfer]




A04_A_5(2Q94)
MAP1_ECOLI
[Raw transfer]




MPH_A_5(1C23)
MAP1_ECOLI
[Raw transfer]




FC3_A_5(2EVC)
MAP1_ECOLI
[Raw transfer]




Q02_A_5(4U73)
MAP11_HUMAN
[Raw transfer]




NLP_A_9(2GU4)
MAP1_ECOLI
[Raw transfer]




FCD_A_4(3IU7)
MAP12_MYCTU
[Raw transfer]




YE6_A_4(2P99)
MAP1_ECOLI
[Raw transfer]




Q06_A_6(4U6C)
MAP11_HUMAN
[Raw transfer]




Y08_A_4(3PKC)
MAP12_MYCTU
[Raw transfer]




U16_A_5(2GG9)
MAP1_ECOLI
[Raw transfer]




NLP_B_8(2GTX)
MAP1_ECOLI
[Raw transfer]




Q08_A_5(4U1B)
MAP11_HUMAN
[Raw transfer]




U11_A_5(2GG0)
MAP1_ECOLI
[Raw transfer]




NLP_A_7(2GTX)
MAP1_ECOLI
[Raw transfer]




Q02_A_4(4U6E)
MAP11_HUMAN
[Raw transfer]




Q04_A_5(4U70)
MAP11_HUMAN
[Raw transfer]




U14_A_5(2GG7)
MAP1_ECOLI
[Raw transfer]




GOL_A_4(2B3L)
MAP11_HUMAN
[Raw transfer]




Q03_A_6(4U71)
MAP11_HUMAN
[Raw transfer]




U13_A_5(2GG3)
MAP1_ECOLI
[Raw transfer]




U12_A_5(2GG2)
MAP1_ECOLI
[Raw transfer]




MF3_A_5(1C22)
MAP1_ECOLI
[Raw transfer]




U19_A_5(2GG5)
MAP1_ECOLI
[Raw transfer]




4L9_B_6(4Z7M)
MAP1_ECOLI
[Raw transfer]




HCM_A_4(4IF7)
MAP12_MYCTU
[Raw transfer]




4L9_A_4(4Z7M)
MAP1_ECOLI
[Raw transfer]




T03_A_5(3IU8)
MAP12_MYCTU
[Raw transfer]




CIT_B_5(3TB5)
?
[Raw transfer]




T07_A_4(3IU9)
MAP12_MYCTU
[Raw transfer]




TMG_A_7(1YVM)
MAP1_ECOLI
[Raw transfer]




TFV_A_2(4IKT)
MAP11_HUMAN
[Raw transfer]




SHX_A_2(4IKU)
MAP11_HUMAN
[Raw transfer]




HM2_A_6(2G6P)
MAP11_HUMAN
[Raw transfer]




CT0_A_10(2EVO)
MAP1_ECOLI
[Raw transfer]




YE6_A_5(2P9A)
MAP1_ECOLI
[Raw transfer]




HED_A_2(4IDY)
MAP12_MYCTU
[Raw transfer]




PVP_A_5(4IKR)
MAP11_HUMAN
[Raw transfer]




FZ1_A_6(4IU6)
MAP11_HUMAN
[Raw transfer]




HM4_A_6(2NQ6)
MAP11_HUMAN
[Raw transfer]




FZ1_A_6(4IU6)
MAP11_HUMAN
[Raw transfer]




7NP_A_2(4PNC)
?
[Raw transfer]




HM5_A_6(2NQ7)
MAP11_HUMAN
[Raw transfer]




CT0_B_9(2EVO)
MAP1_ECOLI
[Raw transfer]




QMS_A_6(2BB7)
MAP1_ECOLI
[Raw transfer]




1AY_A_6(4HXX)
MAP11_HUMAN
[Raw transfer]




LMR_A_8(3TAV)
?
[Raw transfer]




44 PsiBlast_CBE 94.3958%-107 - C2 -4A6W 3.2 ?
49 PsiBlast_CBE 93.9958%-108 - C2 -1C23 4.8 MAP1_ECOLI
1 PsiBlast_PDB 93.9762%-111 - C2 -4FO7 - ? -
50 PsiBlast_CBE 93.7058%-106 - C2 -1C22 2.8 MAP1_ECOLI
47 PsiBlast_CBE 93.5158%-108 - C2 -1C27 4.6 MAP1_ECOLI
48 PsiBlast_CBE 93.5058%-105 - C2 -1C24 4.5 MAP1_ECOLI
2 PsiBlast_PDB 93.4162%-105 - C2 -4FO8 - ? -
130 HHSearch 93.0554% -91 - C2 -3MX6 - MAP1_RICPR -
56 PsiBlast_CBE 92.9958%-105 - C2 -2GU5 4.7 MAP1_ECOLI
35 PsiBlast_CBE 92.8358%-107 - C2 -2Q92 3.1 MAP1_ECOLI
41 PsiBlast_CBE 92.8158%-106 - C2 -4Z7M 7.1 MAP1_ECOLI
131 HHSearch 92.7654% -94 - C2 -3MX6 - MAP1_RICPR -
36 PsiBlast_CBE 92.7658%-106 - C2 -2P9A 3.5 MAP1_ECOLI
61 PsiBlast_CBE 92.6658%-107 - C2 -2GTX 4.5 MAP1_ECOLI
3 PsiBlast_PDB 92.6361%-103 - C2 -4JUQ - ? -
46 PsiBlast_CBE 92.6058%-109 - C2 -1YVM 4.0 MAP1_ECOLI
59 PsiBlast_CBE 92.3458%-105 - C2 -2GU4 4.7 MAP1_ECOLI
43 PsiBlast_CBE 92.3258%-105 - C2 -4PNC 3.4 ?
58 PsiBlast_CBE 92.2458%-105 - C2 -2GU4 4.9 MAP1_ECOLI
55 PsiBlast_CBE 92.2358%-102 - C2 -2GU6 4.8 MAP1_ECOLI
40 PsiBlast_CBE 92.2158%-106 - C2 -4Z7M 6.7 MAP1_ECOLI
62 PsiBlast_CBE 92.1758%-104 - C2 -2GTX 4.5 MAP1_ECOLI
37 PsiBlast_CBE 92.1258%-108 - C2 -2P98 4.3 MAP1_ECOLI
54 PsiBlast_CBE 92.0958%-105 - C2 -2GU6 4.7 MAP1_ECOLI
4 PsiBlast_PDB 91.9258%-106 - C2 -4A6V 4.6 ?
8 PsiBlast_PDB 91.8958%-102 - C2 -2EVM 4.2 MAP1_ECOLI
31 PsiBlast_CBE 91.8858%-102 - C2 -2EVO 3.1 MAP1_ECOLI
57 PsiBlast_CBE 91.8158%-105 - C2 -2GU5 4.7 MAP1_ECOLI
34 PsiBlast_CBE 91.8058%-107 - C2 -2Q94 4.3 MAP1_ECOLI
42 PsiBlast_CBE 91.7958%-109 - C2 -2P99 3.0 MAP1_ECOLI
11 PsiBlast_PDB 91.7958%-105 - C2 -2GG0 3.0 MAP1_ECOLI
13 PsiBlast_PDB 91.7858%-105 - C2 -2GG3 2.9 MAP1_ECOLI
15 PsiBlast_PDB 91.7158%-103 - C2 -2GG7 2.7 MAP1_ECOLI
6 PsiBlast_PDB 91.6358%-108 - C2 -2BB7 4.1 MAP1_ECOLI
32 PsiBlast_CBE 91.6258%-104 - C2 -2Q96 3.9 MAP1_ECOLI
7 PsiBlast_PDB 91.4258%-100 - C2 -2EVC 4.8 MAP1_ECOLI
20 PsiBlast_PDB 91.3858%-106 - C2 -2Q93 3.1 MAP1_ECOLI
12 PsiBlast_PDB 91.3858%-105 - C2 -2GG2 2.9 MAP1_ECOLI
17 PsiBlast_PDB 91.2858%-103 - C2 -2GG9 3.6 MAP1_ECOLI
16 PsiBlast_PDB 91.2458%-105 - C2 -2GG8 3.4 MAP1_ECOLI
5 PsiBlast_PDB 91.2158%-103 - C2 -1XNZ 3.7 MAP1_ECOLI
18 PsiBlast_PDB 91.0058%-104 - C2 -2GGB 4.5 MAP1_ECOLI
9 PsiBlast_PDB 90.9058%-105 - C2 -2EVO 3.2 MAP1_ECOLI
14 PsiBlast_PDB 90.7358%-105 - C2 -2GG5 4.0 MAP1_ECOLI
33 PsiBlast_CBE 90.6158%-107 - C2 -2Q95 3.6 MAP1_ECOLI
30 PsiBlast_CBE 90.3958%-105 - C2 -4A6V 4.5 ?
60 PsiBlast_CBE 90.0258%-105 - C2 -3D27 3.9 MAP1_ECOLI
128 HHSearch 87.4743%-107 - C2 -4IU6 4.9 MAP11_HUMAN
139 HHSearch 87.2345%-104 - C2 -3PKB 4.3 MAP12_MYCTU
79 PsiBlast_CBE 86.7144%-112 - C2 -4IKU 6.0 MAP11_HUMAN
98 PsiBlast_CBE 86.5744%-111 - C2 -4U70 3.7 MAP11_HUMAN
86 PsiBlast_CBE 86.4344%-111 - C2 -2B3L 2.1 MAP11_HUMAN
138 HHSearch 86.4245%-104 - C2 -3PKE 5.8 MAP12_MYCTU
96 PsiBlast_CBE 86.4144%-112 - C2 -4U73 3.9 MAP11_HUMAN
89 PsiBlast_CBE 86.3844%-112 - C2 -4HXX 5.7 MAP11_HUMAN
113 PsiBlast_CBE 86.3341%-111 - C2 -3TB5 3.1 ?
94 PsiBlast_CBE 86.2644%-111 - C2 -4U76 2.9 MAP11_HUMAN
83 PsiBlast_CBE 86.1444%-112 - C2 -2NQ7 3.4 MAP11_HUMAN
84 PsiBlast_CBE 85.9544%-112 - C2 -2NQ6 3.7 MAP11_HUMAN
106 PsiBlast_CBE 85.9345%-109 - C2 -3PKC 5.1 MAP12_MYCTU
93 PsiBlast_CBE 85.9245%-105 - C2 -3IU7 3.0 MAP12_MYCTU
82 PsiBlast_CBE 85.9044%-115 - C2 -4IKR 4.9 MAP11_HUMAN
73 PsiBlast_CBE 85.8044%-113 - C2 -4FLI 4.7 MAP11_HUMAN
97 PsiBlast_CBE 85.7744%-108 - C2 -4U71 3.8 MAP11_HUMAN
71 PsiBlast_CBE 85.7644%-112 - C2 -4FLK 5.8 MAP11_HUMAN
102 PsiBlast_CBE 85.7145%-108 - C2 -4IF7 2.5 MAP12_MYCTU
77 PsiBlast_CBE 85.6144%-110 - C2 -4U69 4.0 MAP11_HUMAN
80 PsiBlast_CBE 85.5144%-112 - C2 -4IKT 6.7 MAP11_HUMAN
78 PsiBlast_CBE 85.5144%-111 - C2 -4U1B 3.4 MAP11_HUMAN
69 PsiBlast_CBE 85.4044%-111 - C2 -4IU6 4.9 MAP11_HUMAN
107 PsiBlast_CBE 85.2245%-106 - C2 -3PKB 4.3 MAP12_MYCTU
75 PsiBlast_CBE 85.2144%-112 - C2 -4U6E 4.1 MAP11_HUMAN
91 PsiBlast_CBE 85.1145%-108 - C2 -3IU9 3.5 MAP12_MYCTU
105 PsiBlast_CBE 84.9845%-109 - C2 -3PKD 5.6 MAP12_MYCTU
104 PsiBlast_CBE 84.9045%-106 - C2 -3PKE 5.8 MAP12_MYCTU
90 PsiBlast_CBE 84.8444%-109 - C2 -2G6P 5.8 MAP11_HUMAN
103 PsiBlast_CBE 84.4445%-109 - C2 -4IDY 2.5 MAP12_MYCTU
76 PsiBlast_CBE 84.4244%-109 - C2 -4U6C 4.3 MAP11_HUMAN
92 PsiBlast_CBE 84.3245%-106 - C2 -3IU8 4.4 MAP12_MYCTU
108 PsiBlast_CBE 83.9745%-108 - C2 -3PKA 5.6 MAP12_MYCTU
135 HHSearch 79.3956% -19 - C2 -2Q95 3.6 MAP1_ECOLI
118 PsiBlast_CBE 76.1139% -50 - C2 -3TAV 2.3 ?