@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VR34: (2017-11-30 )
MNIQALLLITSAIFISACSPYIVTANPNYSASKSDEKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRIGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVNPQVGWLTGWVVQPQGNIVAFSLNLEMKKGISSSVRKEITYRGLEQLGIL

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DRW_A_3(3PAE)
?
[Raw transfer]




DRW_B_5(3PAE)
?
[Raw transfer]




DRW_B_7(3PAG)
?
[Raw transfer]




4J6_C_10(5L2F)
?
[Raw transfer]




DRW_A_3(3PAG)
?
[Raw transfer]




4J6_D_14(5L2F)
?
[Raw transfer]




SOY_A_2(4F94)
?
[Raw transfer]




4J6_A_5(5L2F)
?
[Raw transfer]




9CP_A_7(5VFD)
?
[Raw transfer]




FMT_B_9(5KZH)
?
[Raw transfer]




4J6_B_8(5L2F)
?
[Raw transfer]




FMT_D_15(5KZH)
?
[Raw transfer]




FMT_A_5(5KZH)
?
[Raw transfer]




AZR_A_2(4X53)
?
[Raw transfer]




FMT_C_13(5KZH)
?
[Raw transfer]




MER_B_5(4JF4)
?
[Raw transfer]




NXL_A_2(4WM9)
?
[Raw transfer]




ALP_C_7(4Y0U)
?
[Raw transfer]




CIT_A_2(4K0W)
?
[Raw transfer]




MER_A_4(4JF4)
?
[Raw transfer]




ALP_A_5(4Y0U)
?
[Raw transfer]




ALP_D_8(4Y0U)
?
[Raw transfer]




ALP_B_6(4Y0U)
?
[Raw transfer]




CTJ_A_3(4X55)
?
[Raw transfer]




J4W_A_2(5TG6)
?
[Raw transfer]




JW3_A_2(5TG7)
?
[Raw transfer]




JW8_A_2(5TG5)
?
[Raw transfer]




JW1_A_2(5TG4)
?
[Raw transfer]




JW8_A_3(5TG5)
?
[Raw transfer]




TOE_A_2(4ZDX)
?
[Raw transfer]




CO2_A_5(5MOX)
?
[Raw transfer]




CO2_A_9(4WM9)
?
[Raw transfer]




CO2_D_21(4WZ5)
BLO10_PSEAI
[Raw transfer]




CO2_C_16(4WZ5)
BLO10_PSEAI
[Raw transfer]




1 PsiBlast_PDB 96.1495% -82 - C3 -4ZDX 2.2 ?
26 PsiBlast_CBE 95.8395% -81 - C3 -5KZH 3.7 ?
24 PsiBlast_CBE 95.7995% -80 - C3 -5KZH 3.7 ?
25 PsiBlast_CBE 95.5395% -82 - C3 -5KZH 3.6 ?
3 PsiBlast_PDB 94.4495% -78 - C3 -5L2F 4.6 ?
21 PsiBlast_CBE 94.3095% -79 - C3 -5L2F 4.3 ?
2 PsiBlast_PDB 94.0795% -81 - C3 -5KZH 3.6 ?
23 PsiBlast_CBE 93.9195% -78 - C3 -5L2F 3.9 ?
22 PsiBlast_CBE 93.8895% -78 - C3 -5L2F 4.2 ?
162 HHSearch 91.4995% -57 - C3 -5KZH - ? -
163 HHSearch 91.4895% -54 * C3 *5KZH - ? -
11 PsiBlast_PDB 89.7165% -84 - C3 -5VFD 3.8 ?
29 PsiBlast_CBE 88.6762%-100 - C3 -4JF4 3.8 ?
10 PsiBlast_PDB 88.4865% -84 - C3 -3G4P - ? -
7 PsiBlast_PDB 88.0765% -85 - C3 -5TG7 3.7 ?
14 PsiBlast_PDB 87.9965% -84 - C3 -5TG6 3.8 ?
16 PsiBlast_PDB 87.3762% -98 - C3 -4JF4 3.2 ?
6 PsiBlast_PDB 87.2565% -80 - C3 -5TG5 3.9 ?
19 PsiBlast_PDB 86.8561% -95 - C3 -4X55 2.5 ?
17 PsiBlast_PDB 86.7862%-100 - C3 -4JF5 - ? -
8 PsiBlast_PDB 86.2265% -78 - C3 -3PAE 5.6 ?
13 PsiBlast_PDB 85.8765% -76 - C3 -3PAG 3.6 ?
12 PsiBlast_PDB 85.8565% -81 - C3 -5TG4 3.8 ?
28 PsiBlast_CBE 85.7565% -77 - C3 -3PAG 4.3 ?
27 PsiBlast_CBE 85.3665% -76 - C3 -3PAE 5.5 ?
5 PsiBlast_PDB 85.0765% -76 - C3 -4WM9 4.1 ?
9 PsiBlast_PDB 84.9665% -75 - C3 -4F94 4.2 ?
15 PsiBlast_PDB 82.2465% -67 - C3 -4X53 4.1 ?
18 PsiBlast_PDB 79.8462% -70 - C3 -4K0W 3.2 ?
31 PsiBlast_CBE 68.4148% 35 - C3 -4Y0U 3.9 ?
30 PsiBlast_CBE 68.1948% 37 - C3 -4Y0U 3.8 ?
32 PsiBlast_CBE 67.8148% 37 - C3 -4Y0U 3.8 ?
33 PsiBlast_CBE 67.7848% 38 - C3 -4Y0U 3.6 ?
73 PsiBlast_CBE 57.5635% 28 - C3 -4WZ5 3.8 BLO10_PSEAI
74 PsiBlast_CBE 56.8935% 26 - C3 -4WZ5 4.0 BLO10_PSEAI
70 PsiBlast_CBE 56.8635% 33 - C3 -5MOX 3.6 ?