@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VRF8: (2017-12-02 )
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMADGPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQCGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLKGVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSFATLAADEAVEQTVNKVKELRAALDELV

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IGP_A_3(1QOQ)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RH9)
TRPA_SALTY
[Raw transfer]




IGP_A_3(1KFB)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1A5S)
TRPA_SALTY
[Raw transfer]




FIP_A_5(1A50)
TRPA_SALTY
[Raw transfer]




IPL_A_3(1QOP)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RHG)
TRPA_SALTY
[Raw transfer]




HSP_A_5(1CW2)
TRPA_SALTY
[Raw transfer]




HE1_A_4(1C8V)
TRPA_SALTY
[Raw transfer]




F19_A_3(2CLO)
TRPA_SALTY
[Raw transfer]




HE1_A_5(1C29)
TRPA_SALTY
[Raw transfer]




NHP_A_4(1CX9)
TRPA_SALTY
[Raw transfer]




IPL_A_4(2TRS)
TRPA_SALTY
[Raw transfer]




F19_A_4(2CLH)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLM)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1FUY)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K8Z)
TRPA_SALTY
[Raw transfer]




F6F_A_3(5BW6)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K7E)
TRPA_SALTY
[Raw transfer]




IAV_E_5(1K7F)
TRPA_SALTY
[Raw transfer]




HF1_A_5(1C9D)
TRPA_SALTY
[Raw transfer]




G3P_A_3(1WBJ)
TRPA_SALTY
[Raw transfer]




G3P_C_8(5EY5)
?
[Raw transfer]




G3P_A_4(2TSY)
TRPA_SALTY
[Raw transfer]




G3H_A_3(2CLK)
TRPA_SALTY
[Raw transfer]




G3P_A_3(2J9X)
TRPA_SALTY
[Raw transfer]




IPL_A_6(1WXJ)
TRPA_THET2
[Raw transfer]




F6F_A_4(2CLE)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLF)
TRPA_SALTY
[Raw transfer]




F6F_A_3(4Y6G)
TRPA_SALTY
[Raw transfer]




F9F_A_3(2CLL)
TRPA_SALTY
[Raw transfer]




13P_A_4(1K8Y)
TRPA_SALTY
[Raw transfer]




G3P_A_6(3CEP)
TRPA_SALTY
[Raw transfer]




CIT_A_2(1UJP)
TRPA_THET2
[Raw transfer]




GOL_A_23(1WQ5)
TRPA_ECOLI
[Raw transfer]




F6F_A_4(4WX2)
TRPA_SALTY
[Raw transfer]




F6F_A_4(4ZQC)
TRPA_SALTY
[Raw transfer]




EDO_A_3(3NAV)
TRPA_VIBCH
[Raw transfer]




EDO_A_3(3NAV)
TRPA_VIBCH
[Raw transfer]




PEG_A_6(4KKX)
TRPA_SALTY
[Raw transfer]




113 HHSearch 87.3043%-115 - C1 -5KMY - TRPA_LEGPA -
1 PsiBlast_PDB 85.4145%-145 - C1 -5K9X - TRPA_LEGPH -
21 PsiBlast_CBE 84.9345%-136 - C1 -5EY5 3.3 ?
2 PsiBlast_PDB 83.9045%-145 - C1 -5KMY - TRPA_LEGPA -
3 PsiBlast_PDB 82.2239%-128 - C1 -2EKC - TRPA_AQUAE -
88 PsiBlast_CBE 81.7133%-115 - C1 -1QOP 6.5 TRPA_SALTY
87 PsiBlast_CBE 81.6533%-114 - C1 -1WBJ 4.4 TRPA_SALTY
86 PsiBlast_CBE 81.6533%-114 - C1 -2CLK 4.4 TRPA_SALTY
76 PsiBlast_CBE 81.5833%-116 - C1 -1K3U - TRPA_SALTY -
104 Fugue 81.4538%-139 - C1 -1GEQ - TRPA_PYRFU -
70 PsiBlast_CBE 81.4433%-115 - C1 -1TJP - TRPA_SALTY -
116 HHSearch 81.3535%-140 - C1 -5TCH - ? -
85 PsiBlast_CBE 81.1033%-117 - C1 -3CEP 4.9 TRPA_SALTY
125 HHSearch 80.7336%-120 * C1 *5CGQ - TRPA_SALTY -
54 PsiBlast_CBE 80.7333%-112 - C1 -4HT3 - TRPA_SALTY -
97 PsiBlast_CBE 80.6733%-119 - C1 -3PR2 - TRPA_SALTY -
82 PsiBlast_CBE 80.5233%-113 - C1 -1C29 3.6 TRPA_SALTY
47 PsiBlast_CBE 80.4733%-111 - C1 -5CGQ - TRPA_SALTY -
126 HHSearch 80.3836%-120 - C1 -4HPX - TRPA_SALTY -
81 PsiBlast_CBE 80.2633%-113 - C1 -1C8V 6.1 TRPA_SALTY
78 PsiBlast_CBE 80.2233%-114 - C1 -1CX9 4.1 TRPA_SALTY
77 PsiBlast_CBE 80.0933%-118 - C1 -1FUY 6.2 TRPA_SALTY
79 PsiBlast_CBE 79.9433%-116 - C1 -1CW2 5.0 TRPA_SALTY
84 PsiBlast_CBE 79.7633%-119 - C1 -1A50 6.7 TRPA_SALTY
4 PsiBlast_PDB 79.7042%-170 - C1 -1UJP 3.4 TRPA_THET2
80 PsiBlast_CBE 79.6133%-114 - C1 -1C9D 6.0 TRPA_SALTY
67 PsiBlast_CBE 79.6033%-122 - C1 -2CLH 5.1 TRPA_SALTY
72 PsiBlast_CBE 79.4933%-123 - C1 -1K8Z 4.7 TRPA_SALTY
53 PsiBlast_CBE 79.4633%-109 - C1 -4KKX 2.7 TRPA_SALTY
59 PsiBlast_CBE 79.2933%-120 - C1 -2TRS 5.7 TRPA_SALTY
49 PsiBlast_CBE 79.1833%-117 - C1 -4ZQC 4.3 TRPA_SALTY
65 PsiBlast_CBE 79.0033%-121 - C1 -2CLL 5.9 TRPA_SALTY
62 PsiBlast_CBE 78.8533%-115 - C1 -2J9X 3.9 TRPA_SALTY
71 PsiBlast_CBE 78.8433%-125 - C1 -1QOQ 5.1 TRPA_SALTY
63 PsiBlast_CBE 78.7933%-121 - C1 -2CLO 6.7 TRPA_SALTY
75 PsiBlast_CBE 78.6033%-124 - C1 -1K7E 4.9 TRPA_SALTY
74 PsiBlast_CBE 78.5733%-128 - C1 -1K7F 4.6 TRPA_SALTY
58 PsiBlast_CBE 78.5033%-116 - C1 -2TSY 3.0 TRPA_SALTY
50 PsiBlast_CBE 78.4233%-121 - C1 -4Y6G 5.0 TRPA_SALTY
83 PsiBlast_CBE 78.3833%-118 - C1 -1A5S 6.2 TRPA_SALTY
61 PsiBlast_CBE 78.3133%-126 - C1 -2RH9 5.5 TRPA_SALTY
73 PsiBlast_CBE 78.1233%-127 - C1 -1K8Y 3.0 TRPA_SALTY
5 PsiBlast_PDB 77.7042%-169 - C1 -1WXJ 5.4 TRPA_THET2
60 PsiBlast_CBE 77.2133%-125 - C1 -2RHG 5.2 TRPA_SALTY
124 HHSearch 77.1835%-113 - C1 -3NAV 2.7 TRPA_VIBCH
69 PsiBlast_CBE 76.9733%-124 - C1 -2CLE 4.9 TRPA_SALTY
99 PsiBlast_CBE 76.9633%-122 - C1 -1KFB 5.2 TRPA_SALTY
52 PsiBlast_CBE 76.8933%-124 - C1 -4WX2 4.3 TRPA_SALTY
68 PsiBlast_CBE 76.6533%-123 - C1 -2CLF 4.0 TRPA_SALTY
48 PsiBlast_CBE 76.4133%-126 - C1 -5BW6 4.1 TRPA_SALTY
64 PsiBlast_CBE 76.3833%-126 - C1 -2CLM 4.7 TRPA_SALTY
93 PsiBlast_CBE 73.1932%-130 - C1 -1WQ5 3.1 TRPA_ECOLI
11 PsiBlast_PDB 68.4536%-132 - C1 -3NAV 2.7 TRPA_VIBCH