@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSA9: (2017-12-07 )
MRIILLGPPGAGKGTQAQLICKRYNIPQISTGDMLRAAIREGTELGLKAKSVMESGGLVSDELIIGLVKERIAQPDCVNGCIFDGFPRTIPQAEALEKEGISIDHVIEIDVPDEEIVKRLSGRRQHPASGRVYHVVYNPPKVEGKDDETGEDLVQRPDDQEETIRKRLASYHTETEQLVGFYQGRAASGENAPTYDKLDGLRTIEDVQKDLFNILDK

Atome Classification :

(103 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AP5_B_8(2ORI)
KAD_BACSU
[Raw transfer]




AP5_B_8(2QAJ)
KAD_BACSU
[Raw transfer]




AP5_B_4(3HPR)
KAD_ECOLI
[Raw transfer]




AP5_B_4(3HPQ)
KAD_ECOLI
[Raw transfer]




AP5_B_9(2EU8)
KAD_BACSU
[Raw transfer]




AP5_A_3(4QBF)
KAD_BACSU
[Raw transfer]




AP5_B_8(4QBI)
KAD_GEOSE
[Raw transfer]




AP5_A_4(2P3S)
KAD_BACSU
[Raw transfer]




AP5_A_3(1AKE)
KAD_ECOLI
[Raw transfer]




AP5_A_4(4MKG)
KAD_BACSU
[Raw transfer]




AP5_B_6(4X8L)
KAD_ECOLI
[Raw transfer]




AP5_A_3(1E4Y)
KAD_ECOLI
[Raw transfer]




AP5_B_8(2OO7)
KAD_BACSU
[Raw transfer]




AP5_A_7(2QAJ)
KAD_BACSU
[Raw transfer]




AP5_A_7(2ORI)
KAD_BACSU
[Raw transfer]




AP5_A_7(2OSB)
KAD_BACSU
[Raw transfer]




AP5_A_8(2EU8)
KAD_BACSU
[Raw transfer]




AP5_B_4(1AKE)
KAD_ECOLI
[Raw transfer]




AP5_A_4(1ZIP)
KAD_GEOSE
[Raw transfer]




AP5_B_6(4X8O)
KAD_ECOLI
[Raw transfer]




AP5_B_6(4X8O)
KAD_ECOLI
[Raw transfer]




AP5_B_9(2EU8)
KAD_BACSU
[Raw transfer]




AP5_A_7(2OO7)
KAD_BACSU
[Raw transfer]




AP5_A_3(3HPQ)
KAD_ECOLI
[Raw transfer]




AP5_A_3(1AKE)
KAD_ECOLI
[Raw transfer]




AP5_B_8(3DL0)
KAD_BACSU
[Raw transfer]




AP5_A_3(5G41)
?
[Raw transfer]




AP5_A_7(3DL0)
KAD_BACSU
[Raw transfer]




AP5_B_8(2OSB)
KAD_BACSU
[Raw transfer]




AP5_A_3(3BE4)
?
[Raw transfer]




AP5_A_3(3BE4)
?
[Raw transfer]




AP5_B_5(5EJE)
KAD_ECOLI
[Raw transfer]




AP5_A_3(5G3Z)
?
[Raw transfer]




AP5_A_4(1P3J)
KAD_BACSU
[Raw transfer]




AP5_A_6(2RGX)
KAD_AQUAE
[Raw transfer]




AP5_A_3(4X8O)
KAD_ECOLI
[Raw transfer]




AP5_A_2(1AKY)
KAD2_YEAST
[Raw transfer]




ANP_B_6(1ANK)
KAD_ECOLI
[Raw transfer]




AP5_B_4(1E4V)
KAD_ECOLI
[Raw transfer]




AP5_A_3(4X8L)
KAD_ECOLI
[Raw transfer]




AP5_A_5(4QBI)
KAD_GEOSE
[Raw transfer]




ADP_A_3(3SR0)
KAD_AQUAE
[Raw transfer]




AP5_A_2(3AKY)
KAD2_YEAST
[Raw transfer]




AP5_A_3(5EJE)
KAD_ECOLI
[Raw transfer]




AP5_A_3(2AKY)
KAD2_YEAST
[Raw transfer]




AP5_A_3(3HPR)
KAD_ECOLI
[Raw transfer]




AP5_B_7(4TYP)
KAD_BACSU
[Raw transfer]




AP5_B_4(1E4Y)
KAD_ECOLI
[Raw transfer]




AP5_A_3(1S3G)
KAD_SPOGL
[Raw transfer]




AP5_A_5(4MKF)
KAD_BACSU
[Raw transfer]




AP5_A_3(4MKH)
KAD_BACSU
[Raw transfer]




AP5_A_3(1E4V)
KAD_ECOLI
[Raw transfer]




ANP_A_4(1ANK)
KAD_ECOLI
[Raw transfer]




AP5_A_3(3FB4)
?
[Raw transfer]




AP5_B_7(4TYQ)
KAD_BACSU
[Raw transfer]




ADP_B_5(4JLD)
KAD_AQUAE
[Raw transfer]




ATF_B_4(1DVR)
KAD2_YEAST
[Raw transfer]




ATF_A_3(1DVR)
KAD2_YEAST
[Raw transfer]




AP5_A_4(3DKV)
KAD_BACSU
[Raw transfer]




AP5_A_5(3X2S)
?
[Raw transfer]




AP5_A_3(1ZIN)
KAD_GEOSE
[Raw transfer]




ADP_A_3(4JZK)
?
[Raw transfer]




ADP_B_7(3SR0)
KAD_AQUAE
[Raw transfer]




AP5_B_9(3X2S)
?
[Raw transfer]




ADP_B_6(2ECK)
KAD_ECOLI
[Raw transfer]




AP5_B_11(4MKF)
KAD_BACSU
[Raw transfer]




AP5_A_9(4TYP)
KAD_BACSU
[Raw transfer]




ADP_A_3(4JZK)
?
[Raw transfer]




ADP_B_6(4JL5)
KAD_AQUAE
[Raw transfer]




AP5_A_3(4TYQ)
KAD_BACSU
[Raw transfer]




ADP_A_4(2ECK)
KAD_ECOLI
[Raw transfer]




AP5_A_4(1ZIO)
KAD_GEOSE
[Raw transfer]




AP5_B_3(4QBG)
KAD_BACSU
[Raw transfer]




ADP_A_3(5G40)
?
[Raw transfer]




AP5_B_3(4QBG)
KAD_BACSU
[Raw transfer]




ADP_B_5(3TLX)
?
[Raw transfer]




ADP_A_2(4K46)
KAD_PHOPR
[Raw transfer]




ADP_A_4(4IKE)
KAD_AQUAE
[Raw transfer]




ADP_A_11(3TLX)
?
[Raw transfer]




ADP_B_6(4JLB)
KAD_AQUAE
[Raw transfer]




ADP_B_5(4JZK)
?
[Raw transfer]




GP5_A_3(2BBW)
KAD4_HUMAN
[Raw transfer]




B4P_A_2(2C9Y)
KAD2_HUMAN
[Raw transfer]




ADP_B_6(4IKE)
KAD_AQUAE
[Raw transfer]




ADP_A_4(5G3Y)
?
[Raw transfer]




ADP_B_7(4JKY)
KAD_AQUAE
[Raw transfer]




ADP_A_4(5G3Y)
?
[Raw transfer]




ADP_A_4(4CF7)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLA)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4JLA)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4CF7)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL8)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JKY)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL6)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL5)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4JL8)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLD)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLB)
KAD_AQUAE
[Raw transfer]




AMP_A_3(1ANK)
KAD_ECOLI
[Raw transfer]




ADP_B_6(4JL6)
KAD_AQUAE
[Raw transfer]




AMP_B_5(1ANK)
KAD_ECOLI
[Raw transfer]




AMP_A_5(2AK3)
KAD3_BOVIN
[Raw transfer]




SRT_A_3(2XB4)
?
[Raw transfer]




IMD_A_3(1AKY)
KAD2_YEAST
[Raw transfer]




PEG_C_11(4PZL)
KAD_FRATT
[Raw transfer]




11 PsiBlast_PDB 91.0462% -75 - C2 -4X8O 15.3 KAD_ECOLI
2 PsiBlast_PDB 90.7362% -69 - C2 -4X8L 14.8 KAD_ECOLI
31 PsiBlast_CBE 90.6661% -77 - C2 -5EJE 13.7 KAD_ECOLI
24 PsiBlast_CBE 90.4162% -70 - C2 -2ECK 8.9 KAD_ECOLI
21 PsiBlast_CBE 90.3762% -69 - C2 -4X8L 14.8 KAD_ECOLI
23 PsiBlast_CBE 90.2062% -65 - C2 -3HPQ 14.2 KAD_ECOLI
3 PsiBlast_PDB 90.0962% -71 - C2 -1AKE 14.1 KAD_ECOLI
10 PsiBlast_PDB 89.8262% -93 - C2 -4X8M - KAD_ECOLI -
28 PsiBlast_CBE 89.7662% -65 - C2 -4X8O 15.3 KAD_ECOLI
4 PsiBlast_PDB 89.7662% -70 - C2 -1ANK 10.4 KAD_ECOLI
14 PsiBlast_PDB 89.6461% -77 - C2 -5EJE 13.2 KAD_ECOLI
7 PsiBlast_PDB 89.2962% -69 - C2 -3HPQ 13.8 KAD_ECOLI
8 PsiBlast_PDB 89.2762% -68 - C2 -4JZK 8.0 ?
1 PsiBlast_PDB 89.0162% -88 - C2 -4X8H - KAD_ECOLI -
12 PsiBlast_PDB 88.9662% -72 - C2 -1E4V 14.7 KAD_ECOLI
27 PsiBlast_CBE 88.8862% -68 - C2 -3HPR 12.7 KAD_ECOLI
9 PsiBlast_PDB 88.8562% -68 - C2 -3HPR 13.8 KAD_ECOLI
6 PsiBlast_PDB 88.7762% -69 - C2 -2ECK 9.0 KAD_ECOLI
32 PsiBlast_CBE 88.1161% -78 - C2 -1E4Y 14.1 KAD_ECOLI
15 PsiBlast_PDB 87.9761% -79 - C2 -1E4Y 13.6 KAD_ECOLI
26 PsiBlast_CBE 87.9562% -67 - C2 -1AKE 15.4 KAD_ECOLI
30 PsiBlast_CBE 87.8562% -63 - C2 -3X2S 14.3 ?
116 HHSearch 87.7963% -47 - C2 -4X8O 15.3 KAD_ECOLI
22 PsiBlast_CBE 87.5162% -64 - C2 -4JZK 8.2 ?
29 PsiBlast_CBE 87.5062% -71 - C2 -1E4V 14.9 KAD_ECOLI
25 PsiBlast_CBE 87.3762% -64 - C2 -1ANK 9.2 KAD_ECOLI
118 HHSearch 87.2463% -48 - C2 -4JZK 8.0 ?
13 PsiBlast_PDB 86.5962% -62 - C2 -3X2S 13.5 ?
16 PsiBlast_PDB 85.3261% -62 - C2 -4K46 9.6 KAD_PHOPR
115 HHSearch 84.0149% -53 - C2 -4QBG 13.7 KAD_BACSU
34 PsiBlast_CBE 83.0851% -80 - C2 -4PZL 2.7 KAD_FRATT
61 PsiBlast_CBE 82.8347% -53 - C2 -4TYQ 14.8 KAD_BACSU
52 PsiBlast_CBE 82.5147% -50 - C2 -4QBG 13.7 KAD_BACSU
80 PsiBlast_CBE 81.8747% -52 - C2 -3DL0 15.1 KAD_BACSU
124 HHSearch 80.8356% -32 - C2 -5G3Y 8.9 ?
60 PsiBlast_CBE 80.4947% -47 - C2 -4TYQ 14.8 KAD_BACSU
54 PsiBlast_CBE 80.4548% -50 - C2 -3DKV 14.9 KAD_BACSU
62 PsiBlast_CBE 80.4148% -42 - C2 -4QBF 14.2 KAD_BACSU
46 PsiBlast_CBE 80.3047% -50 - C2 -3FB4 15.6 ?
81 PsiBlast_CBE 80.0147% -47 - C2 -3DL0 15.3 KAD_BACSU
53 PsiBlast_CBE 79.9948% -45 - C2 -4MKG 15.4 KAD_BACSU
75 PsiBlast_CBE 79.8646% -49 - C2 -2OO7 15.5 KAD_BACSU
76 PsiBlast_CBE 79.8246% -49 - C2 -2OSB 14.6 KAD_BACSU
79 PsiBlast_CBE 79.6546% -50 - C2 -4MKF 15.7 KAD_BACSU
117 HHSearch 79.6250% -49 - C2 -3BE4 14.5 ?
74 PsiBlast_CBE 79.5646% -42 - C2 -2OO7 15.0 KAD_BACSU
63 PsiBlast_CBE 79.5548% -51 - C2 -4MKH 14.2 KAD_BACSU
51 PsiBlast_CBE 79.4847% -43 - C2 -4TYP 14.0 KAD_BACSU
72 PsiBlast_CBE 79.2047% -48 - C2 -2ORI 14.5 KAD_BACSU
114 HHSearch 79.0349% -44 - C2 -2EU8 14.8 KAD_BACSU
71 PsiBlast_CBE 79.0047% -41 - C2 -2ORI 14.9 KAD_BACSU
68 PsiBlast_CBE 78.6847% -49 - C2 -2EU8 14.7 KAD_BACSU
67 PsiBlast_CBE 78.6747% -42 - C2 -2EU8 14.8 KAD_BACSU
78 PsiBlast_CBE 78.6646% -47 - C2 -4MKF 15.1 KAD_BACSU
66 PsiBlast_CBE 78.6547% -38 - C2 -2P3S 14.6 KAD_BACSU
77 PsiBlast_CBE 78.4246% -53 - C2 -2OSB 14.4 KAD_BACSU
64 PsiBlast_CBE 78.3746% -45 - C2 -2QAJ 15.0 KAD_BACSU
65 PsiBlast_CBE 78.3146% -48 - C2 -2QAJ 14.7 KAD_BACSU
39 PsiBlast_CBE 78.1449% -39 - C2 -1S3G 14.4 KAD_SPOGL
40 PsiBlast_CBE 77.9455% -55 - C2 -5G3Z 15.2 ?
50 PsiBlast_CBE 77.7347% -39 - C2 -4TYP 12.5 KAD_BACSU
128 HHSearch 77.3040%-108 - C2 -2AK3 5.3 KAD3_BOVIN
103 Fugue 77.0660% 10 - C2 -1AKE 14.1 KAD_ECOLI
73 PsiBlast_CBE 76.6046% -38 - C2 -1P3J 14.8 KAD_BACSU
49 PsiBlast_CBE 76.3548% -75 - C2 -2C9Y 6.8 KAD2_HUMAN
42 PsiBlast_CBE 75.9854% -51 - C2 -5G41 13.7 ?
58 PsiBlast_CBE 75.5850% -61 - C2 -4QBI 15.4 KAD_GEOSE
96 PsiBlast_CBE 75.2744% -56 - C2 -4IKE 7.0 KAD_AQUAE
57 PsiBlast_CBE 75.2149% -62 - C2 -1ZIN 14.2 KAD_GEOSE
56 PsiBlast_CBE 75.0149% -67 - C2 -1ZIO 13.7 KAD_GEOSE
43 PsiBlast_CBE 74.8254% -48 - C2 -5G40 8.9 ?
55 PsiBlast_CBE 74.8149% -59 - C2 -1ZIP 14.2 KAD_GEOSE
41 PsiBlast_CBE 74.4454% -54 - C2 -3BE4 14.6 ?
82 PsiBlast_CBE 74.4244% -44 - C2 -4JLD 8.9 KAD_AQUAE
20 PsiBlast_PDB 74.3558% -36 - C2 -5G3Y 8.9 ?
85 PsiBlast_CBE 74.2944% -46 - C2 -4JLB 7.9 KAD_AQUAE
92 PsiBlast_CBE 74.2844% -38 - C2 -4JL5 9.5 KAD_AQUAE
59 PsiBlast_CBE 74.2850% -66 - C2 -4QBI 14.5 KAD_GEOSE
89 PsiBlast_CBE 74.1044% -44 - C2 -4JL8 8.2 KAD_AQUAE
97 PsiBlast_CBE 73.9844% -43 - C2 -4IKE 9.1 KAD_AQUAE
87 PsiBlast_CBE 73.8044% -47 - C2 -4JLA 7.5 KAD_AQUAE
95 PsiBlast_CBE 73.7844% -46 - C2 -4JKY 6.9 KAD_AQUAE
91 PsiBlast_CBE 73.6644% -46 - C2 -4JL6 7.7 KAD_AQUAE
88 PsiBlast_CBE 73.6344% -42 - C2 -4JL8 9.2 KAD_AQUAE
100 PsiBlast_CBE 73.5744% -39 - C2 -3SR0 9.0 KAD_AQUAE
99 PsiBlast_CBE 73.5144% -41 - C2 -4CF7 7.5 KAD_AQUAE
83 PsiBlast_CBE 73.5144% -44 - C2 -4JLD 8.3 KAD_AQUAE
101 PsiBlast_CBE 73.5044% -47 - C2 -3SR0 9.3 KAD_AQUAE
90 PsiBlast_CBE 73.4244% -42 - C2 -4JL6 7.5 KAD_AQUAE
93 PsiBlast_CBE 73.1944% -45 - C2 -4JL5 9.7 KAD_AQUAE
84 PsiBlast_CBE 73.1544% -41 - C2 -4JLB 9.5 KAD_AQUAE
86 PsiBlast_CBE 73.1044% -40 - C2 -4JLA 7.8 KAD_AQUAE
102 PsiBlast_CBE 72.7344% -44 - C2 -2RGX 14.0 KAD_AQUAE
94 PsiBlast_CBE 72.1744% -42 - C2 -4JKY 7.4 KAD_AQUAE
98 PsiBlast_CBE 72.1544% -36 - C2 -4CF7 9.3 KAD_AQUAE
121 HHSearch 71.8948% 5 - C2 -1AKY 2.5 KAD2_YEAST
37 PsiBlast_CBE 69.3552% -14 - C2 -2AKY 15.4 KAD2_YEAST
44 PsiBlast_CBE 69.2551% -13 - C2 -1DVR 7.3 KAD2_YEAST
38 PsiBlast_CBE 69.0052% -10 - C2 -1AKY 15.0 KAD2_YEAST
36 PsiBlast_CBE 67.6852% -7 - C2 -3AKY 14.7 KAD2_YEAST