@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSN0: (2017-12-09 )
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

L34_A_6(4B4V)
?
[Raw transfer]




9L9_A_6(4B4W)
?
[Raw transfer]




L34_A_3(5TC4)
MTDC_HUMAN
[Raw transfer]




9L9_A_5(4CJX)
?
[Raw transfer]




L34_A_3(5TC4)
MTDC_HUMAN
[Raw transfer]




L37_A_6(1DIG)
C1TC_HUMAN
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_D_4(1DIB)
C1TC_HUMAN
[Raw transfer]




NDP_D_4(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_C_3(1DIB)
C1TC_HUMAN
[Raw transfer]




NDP_D_4(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_A_4(1DIG)
C1TC_HUMAN
[Raw transfer]




NAD_A_2(5TC4)
MTDC_HUMAN
[Raw transfer]




NAP_A_3(1DIA)
C1TC_HUMAN
[Raw transfer]




NAP_B_4(1DIA)
C1TC_HUMAN
[Raw transfer]




NAP_B_5(1DIG)
C1TC_HUMAN
[Raw transfer]




NAD_B_5(3P2O)
FOLD_CAMJE
[Raw transfer]




L24_A_5(1DIA)
C1TC_HUMAN
[Raw transfer]




EDO_A_7(4B4U)
?
[Raw transfer]




NAP_B_7(4B4V)
?
[Raw transfer]




NAP_B_7(4B4W)
?
[Raw transfer]




NAP_B_10(4B4U)
?
[Raw transfer]




NAP_B_10(4B4U)
?
[Raw transfer]




IMD_B_7(3L07)
FOLD_FRATT
[Raw transfer]




IMD_B_7(3L07)
FOLD_FRATT
[Raw transfer]




IMD_A_4(3L07)
FOLD_FRATT
[Raw transfer]




EDO_A_6(3L07)
FOLD_FRATT
[Raw transfer]




21 PsiBlast_CBE 98.48100%-134 - C3 -4B4W 6.3 ?
2 PsiBlast_PDB 98.13100%-132 - C3 -4B4V 7.5 ?
22 PsiBlast_CBE 97.91100%-132 - C3 -4B4V 6.3 ?
48 HHSearch 97.52100%-131 - C3 -4B4U 6.4 ?
23 PsiBlast_CBE 97.52100%-131 - C3 -4B4U 6.4 ?
1 PsiBlast_PDB 97.06100%-129 - C3 -4B4U 2.9 ?
3 PsiBlast_PDB 96.92100%-132 - C3 -4B4W 6.9 ?
59 HHSearch 76.4442%-133 - C3 -4A5O - FOLD_PSEAE -
13 PsiBlast_PDB 74.5042%-101 - C3 -4A5O - FOLD_PSEAE -
5 PsiBlast_PDB 73.4444% -75 - C3 -2C2X - FOLD_MYCTU -
49 HHSearch 73.3242%-114 - C3 -1B0A - FOLD_ECOLI -
12 PsiBlast_PDB 73.0742%-117 - C3 -1B0A - FOLD_ECOLI -
15 PsiBlast_PDB 72.4840% -76 - C3 -5TC4 6.5 MTDC_HUMAN
52 HHSearch 71.7945% -77 - C3 -2C2X - FOLD_MYCTU -
63 HHSearch 71.6842% -68 - C3 -3P2O 8.2 FOLD_CAMJE
7 PsiBlast_PDB 71.6741% -68 - C3 -3P2O - FOLD_CAMJE -
51 HHSearch 71.6444% -66 - C3 -3L07 3.1 FOLD_FRATT
24 PsiBlast_CBE 71.5744% -64 - C3 -3L07 3.1 FOLD_FRATT
62 HHSearch 71.4342% -69 - C3 -3P2O - FOLD_CAMJE -
6 PsiBlast_PDB 70.9244% -71 - C3 -2C2Y - FOLD_MYCTU -
4 PsiBlast_PDB 70.2244% -61 - C3 -3L07 3.8 FOLD_FRATT
50 HHSearch 69.4442% -65 * C3 *5TC4 6.5 MTDC_HUMAN
25 PsiBlast_CBE 65.2741% -11 - C3 -1A4I 9.8 C1TC_HUMAN
56 HHSearch 65.2542% -17 - C3 -1A4I 9.6 C1TC_HUMAN
28 PsiBlast_CBE 65.2241% -10 - C3 -1DIA 8.8 C1TC_HUMAN
8 PsiBlast_PDB 65.1641% -15 - C3 -1A4I 10.1 C1TC_HUMAN
27 PsiBlast_CBE 64.6041% -9 - C3 -1DIB 8.9 C1TC_HUMAN
10 PsiBlast_PDB 64.2441% -13 - C3 -1DIB 8.6 C1TC_HUMAN
11 PsiBlast_PDB 63.7441% -13 - C3 -1DIG 8.9 C1TC_HUMAN
9 PsiBlast_PDB 63.6841% -11 - C3 -1DIA 9.0 C1TC_HUMAN
26 PsiBlast_CBE 63.3941% -10 - C3 -1DIG 8.4 C1TC_HUMAN
55 HHSearch 63.0542% -5 - C3 -1A4I 9.9 C1TC_HUMAN
38 Fugue 59.0542% 22 - C3 -1A4I 9.9 C1TC_HUMAN