@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTE5: (2017-12-13 )
MKVQVKLLDPRLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRGQTTFRLEPGERLAQYVLVPVVQAEFEQVEEFEETLRGAGGFGHTGKQ

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DUD_B_9(3C3I)
?
[Raw transfer]




DUT_C_8(1SM8)
DUT_MYCTU
[Raw transfer]




DUT_A_6(1SMC)
DUT_MYCTU
[Raw transfer]




DUP_A_4(5F9K)
DUT_DICDI
[Raw transfer]




DUP_B_5(5F9K)
DUT_DICDI
[Raw transfer]




DUD_B_9(1SLH)
DUT_MYCTU
[Raw transfer]




DUT_C_5(1SMC)
DUT_MYCTU
[Raw transfer]




DUP_B_5(5F9K)
DUT_DICDI
[Raw transfer]




DUT_B_9(1SM8)
DUT_MYCTU
[Raw transfer]




DUP_B_7(3P48)
DUT_YEAST
[Raw transfer]




DUP_B_7(3P48)
DUT_YEAST
[Raw transfer]




DUP_C_12(5F9K)
DUT_DICDI
[Raw transfer]




DUD_C_7(1SLH)
DUT_MYCTU
[Raw transfer]




UMP_A_10(1SNF)
DUT_MYCTU
[Raw transfer]




DUP_A_6(2OKE)
?
[Raw transfer]




DUP_B_7(2OKE)
?
[Raw transfer]




DUD_A_8(1SLH)
DUT_MYCTU
[Raw transfer]




DUD_B_7(2OL0)
?
[Raw transfer]




GOL_A_4(1EUW)
DUT_ECOLI
[Raw transfer]




GOL_A_4(1EUW)
DUT_ECOLI
[Raw transfer]




PEG_C_10(3F4F)
DUT_YEAST
[Raw transfer]




UMP_B_11(1SNF)
DUT_MYCTU
[Raw transfer]




DUD_C_6(2OL0)
?
[Raw transfer]




UMP_C_12(1SNF)
DUT_MYCTU
[Raw transfer]




UMP_C_9(3F4F)
DUT_YEAST
[Raw transfer]




DUD_C_8(2OL0)
?
[Raw transfer]




EDO_B_9(2OKB)
?
[Raw transfer]




GOL_A_3(1EU5)
DUT_ECOLI
[Raw transfer]




EDO_A_6(2OKD)
?
[Raw transfer]




EDO_B_7(2OKD)
?
[Raw transfer]




EDO_A_6(2OKD)
?
[Raw transfer]




GOL_A_2(1EU5)
DUT_ECOLI
[Raw transfer]




GOL_A_3(1EUW)
DUT_ECOLI
[Raw transfer]




DUD_D_4(1DUD)
DUT_ECOLI
[Raw transfer]




DUD_A_3(2HR6)
DUT_ECOLI
[Raw transfer]




UC5_A_2(2HRM)
DUT_ECOLI
[Raw transfer]




DUT_A_3(1SYL)
DUT_ECOLI
[Raw transfer]




DUD_B_9(3C3I)
?
[Raw transfer]




PG4_A_2(4LHR)
DUT_BURTA
[Raw transfer]




DUD_B_9(3C3I)
?
[Raw transfer]




DUP_A_9(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_11(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_10(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_6(3P48)
DUT_YEAST
[Raw transfer]




DUP_B_6(3P48)
DUT_YEAST
[Raw transfer]




DUP_A_3(1SIX)
DUT_MYCTU
[Raw transfer]




DUP_B_10(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_8(4OOP)
DUT_ARATH
[Raw transfer]




DUD_B_6(1Q5H)
DUT_HUMAN
[Raw transfer]




UMP_B_6(3F4F)
DUT_YEAST
[Raw transfer]




UMP_C_9(3F4F)
DUT_YEAST
[Raw transfer]




DU3_A_5(3T64)
?
[Raw transfer]




DU3_C_9(3T64)
?
[Raw transfer]




PEG_C_10(3F4F)
DUT_YEAST
[Raw transfer]




4 PsiBlast_PDB 94.2370%-164 - C4 -2HR6 3.8 DUT_ECOLI
5 PsiBlast_PDB 92.9970%-165 - C4 -2HRM 3.9 DUT_ECOLI
6 PsiBlast_PDB 92.6570%-150 - C4 -1EUW 3.0 DUT_ECOLI
1 PsiBlast_PDB 92.4570%-156 - C4 -1DUP - DUT_ECOLI -
3 PsiBlast_PDB 90.9770%-165 - C4 -1DUD 3.4 DUT_ECOLI
8 PsiBlast_PDB 90.6065%-162 - C4 -3TQZ - DUT_COXBU -
7 PsiBlast_PDB 90.4669%-153 - C4 -1SYL 4.0 DUT_ECOLI
2 PsiBlast_PDB 90.0170%-155 - C4 -1EU5 3.0 DUT_ECOLI
9 PsiBlast_PDB 89.3466%-169 - C4 -4LHR 2.7 DUT_BURTA
145 HHSearch 88.8370% -90 - C4 -1EUW 2.5 DUT_ECOLI
135 Fugue 88.0170% -48 - C4 -1DUP - DUT_ECOLI -
147 HHSearch 86.5367% -93 - C4 -3TQZ - DUT_COXBU -
154 HHSearch 75.9736%-123 - C4 -3HZA - DUT_MYCTU -
148 HHSearch 75.8835%-166 - C4 -1Q5H 3.6 DUT_HUMAN
34 PsiBlast_CBE 75.3337%-151 - C4 -1Q5H - DUT_HUMAN -
33 PsiBlast_CBE 74.5437%-153 - C4 -1Q5H - DUT_HUMAN -
157 HHSearch 74.4036%-126 - C4 -4GCY - DUT_MYCTU -
21 PsiBlast_CBE 73.0648% -61 - C4 -3MBQ - DUT_BRUA2 -
25 PsiBlast_CBE 72.0037%-143 - C4 -3EHW - DUT_HUMAN -
23 PsiBlast_CBE 70.8737%-142 - C4 -3EHW - DUT_HUMAN -
98 PsiBlast_CBE 70.6239%-134 - C4 -3F4F 3.0 DUT_YEAST
164 HHSearch 68.3238%-131 - C4 -3P48 4.7 DUT_YEAST
162 HHSearch 68.3133%-147 - C4 -4OOP 4.3 DUT_ARATH
36 PsiBlast_CBE 68.1035%-155 - C4 -3C3I 2.2 ?
71 PsiBlast_CBE 67.9239%-145 - C4 -3P48 4.7 DUT_YEAST
149 HHSearch 67.5836%-124 - C4 -1SJN 2.5 DUT_MYCTU
123 PsiBlast_CBE 67.5136%-111 - C4 -1SJN 3.4 DUT_MYCTU
100 PsiBlast_CBE 67.3739%-138 - C4 -3F4F 2.4 DUT_YEAST
152 HHSearch 67.2935%-139 - C4 -2OKD 2.8 ?
116 PsiBlast_CBE 66.8636%-117 - C4 -1SLH 3.3 DUT_MYCTU
101 PsiBlast_CBE 66.6136%-142 - C4 -5F9K 4.2 DUT_DICDI
160 HHSearch 66.2336%-154 * C4 *3C3I Error ?
102 PsiBlast_CBE 65.9636%-131 - C4 -5F9K 3.2 DUT_DICDI
110 PsiBlast_CBE 65.5436%-118 - C4 -1SMC 2.6 DUT_MYCTU
118 PsiBlast_CBE 65.4636%-117 - C4 -1SLH 2.9 DUT_MYCTU
103 PsiBlast_CBE 65.4536%-138 - C4 -5F9K 2.9 DUT_DICDI
112 PsiBlast_CBE 65.4136%-112 - C4 -1SMC 2.5 DUT_MYCTU
61 PsiBlast_CBE 65.4038%-155 - C4 -2OL0 3.2 ?
113 PsiBlast_CBE 65.3236%-112 - C4 -1SM8 3.4 DUT_MYCTU
161 HHSearch 65.2736%-153 - C4 -3C3I 2.2 ?
121 PsiBlast_CBE 65.1036%-113 - C4 -1SJN 3.3 DUT_MYCTU
165 HHSearch 65.0538%-124 - C4 -3P48 3.4 DUT_YEAST
108 PsiBlast_CBE 64.8136%-113 - C4 -1SNF 3.8 DUT_MYCTU
117 PsiBlast_CBE 64.5936%-113 - C4 -1SLH 3.2 DUT_MYCTU
119 PsiBlast_CBE 64.5836%-111 - C4 -1SIX 3.2 DUT_MYCTU
107 PsiBlast_CBE 64.5536%-117 - C4 -1SNF 2.7 DUT_MYCTU
99 PsiBlast_CBE 64.4939%-129 - C4 -3F4F 3.4 DUT_YEAST
122 PsiBlast_CBE 64.1536%-109 - C4 -1SJN 2.5 DUT_MYCTU
115 PsiBlast_CBE 64.0336%-115 - C4 -1SM8 3.5 DUT_MYCTU
67 PsiBlast_CBE 63.9138%-148 - C4 -2OKD 2.7 ?
109 PsiBlast_CBE 63.8936%-112 - C4 -1SNF 3.7 DUT_MYCTU
59 PsiBlast_CBE 63.6238%-148 - C4 -2OL0 3.4 ?
60 PsiBlast_CBE 62.4938%-146 - C4 -2OL0 3.1 ?
70 PsiBlast_CBE 62.4038%-148 - C4 -2OKB 3.0 ?
65 PsiBlast_CBE 62.3938%-153 - C4 -2OKD 2.8 ?
72 PsiBlast_CBE 62.3839%-138 - C4 -3P48 3.4 DUT_YEAST
159 HHSearch 62.0835%-135 - C4 -5F9K 3.8 DUT_DICDI
64 PsiBlast_CBE 61.5338%-153 - C4 -2OKE 2.9 ?
62 PsiBlast_CBE 61.0638%-147 - C4 -2OKE 4.4 ?
156 HHSearch 50.2131% -10 - C4 -3T64 3.6 ?
155 HHSearch 46.6931% -24 - C4 -3T64 3.4 ?