@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTG7: (2017-12-13 )
MKRVVITGMGINSCIGNSLEEVTHSLKNGISGTRFNPTYAELNFKSHVSAAAEQDFDNIDRKLKRFMGVCAMYAYNSAVAAVEHAGLKAEDLADNPRYGIAGGSGGGSTASVVEMTELLETKGARKVGPFFVPRNMTNTITANVGVAFKLQGIAHSIASACATSADAIGYAYNLIALGKQDLMLAGGGEEDHWSQSLLFDAMGALCSKYNDTPETASRPYSKDRDGFVIAGGGGFVVLESLEHAQARGANILAEVVAYAANSDGADMVAPSGEGATRCILMALEEAKQHGVDKIDYVNTHGTSTPAGDVTELKAMERAFGEGKVPPLSSTKSMTGHSLGAAGVHEAIYSVLMLQNDFIAPNINVTELDEGTEGFDIVLEKRDTKLNTVMSNSFGFGGVNACLIFKKWDA

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

N3A_A_2(3HO9)
FABF_ECOLI
[Raw transfer]




PMN_A_2(3HNZ)
FABF_ECOLI
[Raw transfer]




840_A_2(3I8P)
FABF_ECOLI
[Raw transfer]




N32_A_2(3HO2)
FABF_ECOLI
[Raw transfer]




1X9_A_6(4LS7)
FABF_BACSU
[Raw transfer]




PMN_C_3(2GFX)
FABF_ECOLI
[Raw transfer]




P9A_A_2(3G0Y)
FABF_ECOLI
[Raw transfer]




1X9_B_10(4LS7)
FABF_BACSU
[Raw transfer]




P9C_A_2(3G11)
FABF_ECOLI
[Raw transfer]




1XG_A_3(4LS8)
FABF_BACSU
[Raw transfer]




CER_A_3(1B3N)
FABF_ECOLI
[Raw transfer]




1XG_B_10(4LS8)
FABF_BACSU
[Raw transfer]




TLM_A_9(2WGE)
FAB1_MYCTU
[Raw transfer]




6NA_A_3(2IWZ)
OXSM_HUMAN
[Raw transfer]




6NA_B_5(2IX4)
KASM_ARATH
[Raw transfer]




6NA_A_3(2IX4)
KASM_ARATH
[Raw transfer]




DAO_C_3(2GFY)
FABF_ECOLI
[Raw transfer]




07L_A_5(3U0F)
?
[Raw transfer]




07L_A_5(3U0F)
?
[Raw transfer]




3MQ_A_5(3MQD)
?
[Raw transfer]




3MQ_A_5(3MQD)
?
[Raw transfer]




IPA_A_8(2WGE)
FAB1_MYCTU
[Raw transfer]




IPA_A_5(2WGD)
FAB1_MYCTU
[Raw transfer]




70 PsiBlast_CBE 94.6855% -17 - C1 -1EK4 - FABB_ECOLI -
43 PsiBlast_CBE 94.1855% -21 - C1 -2BYX - FABB_ECOLI -
159 HHSearch 94.0055% -21 * C1 *2VBA - FABB_ECOLI -
69 PsiBlast_CBE 94.0055% -18 - C1 -1EK4 - FABB_ECOLI -
68 PsiBlast_CBE 94.0055% -17 - C1 -1EK4 - FABB_ECOLI -
19 PsiBlast_PDB 93.8655% -17 - C1 -2BZ4 - FABB_ECOLI -
15 PsiBlast_PDB 93.7655% -19 - C1 -2BYW - FABB_ECOLI -
10 PsiBlast_PDB 93.7455% -18 - C1 -2AQB - FABB_ECOLI -
42 PsiBlast_CBE 93.7255% -22 - C1 -2BYX - FABB_ECOLI -
35 PsiBlast_CBE 93.6655% -17 - C1 -2AQ7 - FABB_ECOLI -
16 PsiBlast_PDB 93.4555% -21 - C1 -2BYX - FABB_ECOLI -
74 PsiBlast_CBE 93.4455% -17 - C1 -1F91 - FABB_ECOLI -
54 PsiBlast_CBE 93.4055% -18 - C1 -2BYZ - FABB_ECOLI -
34 PsiBlast_CBE 93.3355% -19 - C1 -2AQ7 - FABB_ECOLI -
44 PsiBlast_CBE 93.2655% -21 - C1 -2BYX - FABB_ECOLI -
14 PsiBlast_PDB 93.2155% -18 - C1 -2VBA - FABB_ECOLI -
8 PsiBlast_PDB 93.1355% -17 - C1 -2BUI - FABB_ECOLI -
57 PsiBlast_CBE 93.0755% -18 - C1 -2BZ3 - FABB_ECOLI -
38 PsiBlast_CBE 92.9055% -21 - C1 -1FJ8 - FABB_ECOLI -
11 PsiBlast_PDB 92.8655% -16 - C1 -2VB7 - FABB_ECOLI -
65 PsiBlast_CBE 89.3852% -21 - C1 -3MQD 3.1 ?
67 PsiBlast_CBE 89.3552% -20 - C1 -3U0F 2.4 ?
151 HHSearch 85.6553% -6 - C1 -3MQD 3.1 ?
155 HHSearch 85.4253% -6 - C1 -3U0F 2.4 ?
112 PsiBlast_CBE 72.9039% -1 - C1 -3HO9 6.4 FABF_ECOLI
114 PsiBlast_CBE 72.8039% -2 - C1 -3HNZ 6.5 FABF_ECOLI
111 PsiBlast_CBE 72.5839% -2 - C1 -3I8P 5.8 FABF_ECOLI
113 PsiBlast_CBE 72.2639% -3 - C1 -3HO2 6.0 FABF_ECOLI
115 PsiBlast_CBE 72.2439% -0 - C1 -3G11 6.0 FABF_ECOLI
117 PsiBlast_CBE 70.5939% 0 - C1 -2GFX 6.2 FABF_ECOLI
116 PsiBlast_CBE 69.6039% 2 - C1 -3G0Y 6.4 FABF_ECOLI
128 PsiBlast_CBE 67.3735% 5 - C1 -2IWZ 3.8 OXSM_HUMAN
124 PsiBlast_CBE 60.4836% 12 - C1 -2IX4 3.5 KASM_ARATH
123 PsiBlast_CBE 60.3436% 14 - C1 -2IX4 2.0 KASM_ARATH
135 PsiBlast_CBE 53.3736% -26 - C1 -2WGE 4.0 FAB1_MYCTU
136 PsiBlast_CBE 51.8236% -26 - C1 -2WGD 2.6 FAB1_MYCTU