@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTH7: (2017-12-13 )
MSKTSVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLFSLEERVALAQSSLGHLSNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERKHQQGW

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_B_11(3OTW)
COAD_HELPY
[Raw transfer]




AGS_B_10(4NAH)
COAD_STAAW
[Raw transfer]




COA_C_13(3OTW)
COAD_HELPY
[Raw transfer]




COA_D_15(3OTW)
COAD_HELPY
[Raw transfer]




COD_A_2(3PXU)
COAD_BURP1
[Raw transfer]




ANP_B_12(3X1K)
?
[Raw transfer]




AGS_E_15(4NAH)
COAD_STAAW
[Raw transfer]




COD_J_10(1B6T)
COAD_ECOLI
[Raw transfer]




AGS_C_12(4NAH)
COAD_STAAW
[Raw transfer]




ACO_C_17(3X1J)
?
[Raw transfer]




AGS_B_10(4NAH)
COAD_STAAW
[Raw transfer]




CIT_E_11(5H7X)
COAD_ACIBS
[Raw transfer]




ADP_C_11(4NAT)
COAD_STAAW
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




AGS_C_7(4NAU)
COAD_STAAW
[Raw transfer]




AGS_D_13(4NAH)
COAD_STAAW
[Raw transfer]




ATP_B_6(1GN8)
COAD_ECOLI
[Raw transfer]




ATP_B_6(1GN8)
COAD_ECOLI
[Raw transfer]




ADP_B_9(4NAT)
COAD_STAAW
[Raw transfer]




PNS_B_22(1QJC)
COAD_ECOLI
[Raw transfer]




PNS_B_8(1H1T)
COAD_ECOLI
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




COA_E_18(3OTW)
COAD_HELPY
[Raw transfer]




APC_C_8(3NBA)
COAD_MYCTU
[Raw transfer]




COA_A_8(3OTW)
COAD_HELPY
[Raw transfer]




COA_F_19(3OTW)
COAD_HELPY
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




GOL_C_25(3X1K)
?
[Raw transfer]




9F5_C_5(5O0D)
?
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




DMS_C_22(3X1K)
?
[Raw transfer]




DMS_F_(3X1K)
?
[Raw transfer]




COD_B_10(5TS2)
COAD_PSEA8
[Raw transfer]




COD_C_13(5TS2)
COAD_PSEA8
[Raw transfer]




ACO_C_17(3X1J)
?
[Raw transfer]




COA_B_16(3X1M)
?
[Raw transfer]




COA_C_20(3X1M)
?
[Raw transfer]




COD_E_20(5TS2)
COAD_PSEA8
[Raw transfer]




COD_D_17(5TS2)
COAD_PSEA8
[Raw transfer]




COA_A_4(3X1M)
?
[Raw transfer]




COD_F_23(5TS2)
COAD_PSEA8
[Raw transfer]




COD_A_7(5TS2)
COAD_PSEA8
[Raw transfer]




COA_B_15(4RUK)
?
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




COA_A_7(4RUK)
?
[Raw transfer]




COA_A_7(4RUK)
?
[Raw transfer]




ACO_B_13(3X1J)
?
[Raw transfer]




COA_C_23(4RUK)
?
[Raw transfer]




DMS_D_21(3X1K)
?
[Raw transfer]




1 PsiBlast_PDB 93.1499%-144 - C1 -5H16 - COAD_ACIBS -
30 PsiBlast_CBE 92.0899%-142 - C1 -5H7X - COAD_ACIBS -
22 PsiBlast_CBE 91.7999%-145 - C1 -5H16 - COAD_ACIBS -
2 PsiBlast_PDB 91.5699%-139 - C1 -5H7X - COAD_ACIBS -
29 PsiBlast_CBE 91.3999%-144 - C1 -5H7X - COAD_ACIBS -
21 PsiBlast_CBE 91.3199%-142 - C1 -5H16 - COAD_ACIBS -
28 PsiBlast_CBE 91.0799%-143 - C1 -5H7X - COAD_ACIBS -
26 PsiBlast_CBE 90.8699%-146 - C1 -5H7X - COAD_ACIBS -
24 PsiBlast_CBE 90.7599%-144 - C1 -5H16 - COAD_ACIBS -
25 PsiBlast_CBE 90.6099%-143 - C1 -5H16 - COAD_ACIBS -
112 HHSearch 89.9099%-144 - C1 -5H7X 2.5 COAD_ACIBS
27 PsiBlast_CBE 89.9099%-144 - C1 -5H7X - COAD_ACIBS -
23 PsiBlast_CBE 89.7699%-144 - C1 -5H16 - COAD_ACIBS -
32 PsiBlast_CBE 78.4267%-159 - C1 -5TS2 1.9 COAD_PSEA8
3 PsiBlast_PDB 77.3567%-158 - C1 -5TS2 2.0 COAD_PSEA8
31 PsiBlast_CBE 77.0967%-161 - C1 -5TS2 2.0 COAD_PSEA8
132 Fugue 76.3759%-148 - C1 -1B6T - COAD_ECOLI -
41 PsiBlast_CBE 75.8967%-154 - C1 -3X1M 3.8 ?
118 HHSearch 75.8159%-151 * C1 *1GN8 7.0 COAD_ECOLI
121 HHSearch 75.8058%-143 - C1 -5JBN - COAD_ECOLI -
6 PsiBlast_PDB 75.7867%-154 - C1 -3X1M 3.8 ?
35 PsiBlast_CBE 75.5267%-164 - C1 -5TS2 2.1 COAD_PSEA8
33 PsiBlast_CBE 75.1167%-160 - C1 -5TS2 2.0 COAD_PSEA8
4 PsiBlast_PDB 74.8367%-151 - C1 -3X1J 3.8 ?
34 PsiBlast_CBE 74.7467%-160 - C1 -5TS2 2.0 COAD_PSEA8
125 HHSearch 73.9554%-154 - C1 -3K9W 5.0 COAD_BURP1
46 PsiBlast_CBE 73.8767%-155 - C1 -3X1K 3.0 ?
48 PsiBlast_CBE 73.6467%-150 - C1 -3X1J 7.5 ?
45 PsiBlast_CBE 73.2667%-158 - C1 -3X1K 2.7 ?
47 PsiBlast_CBE 73.2167%-155 - C1 -3X1K 7.8 ?
123 HHSearch 72.8266%-142 - C1 -4RUK 2.1 ?
43 PsiBlast_CBE 72.6767%-158 - C1 -3X1K 3.6 ?
42 PsiBlast_CBE 72.6167%-145 - C1 -3X1M 3.7 ?
52 PsiBlast_CBE 71.9261%-155 - C1 -1B6T 8.9 COAD_ECOLI
7 PsiBlast_PDB 71.8867%-155 - C1 -4RUK 3.9 ?
49 PsiBlast_CBE 71.7967%-151 - C1 -3X1J 2.0 ?
50 PsiBlast_CBE 71.7461%-161 - C1 -1H1T 3.8 COAD_ECOLI
54 PsiBlast_CBE 71.4661%-158 - C1 -1QJC 4.5 COAD_ECOLI
114 HHSearch 71.0954%-153 - C1 -3PXU 9.3 COAD_BURP1
51 PsiBlast_CBE 70.7361%-160 - C1 -1GN8 7.0 COAD_ECOLI
127 HHSearch 70.6843%-151 - C1 -4NAH 7.1 COAD_STAAW
36 PsiBlast_CBE 70.4867%-152 - C1 -4RUK 2.1 ?
37 PsiBlast_CBE 69.9367%-148 - C1 -4RUK 2.1 ?
65 PsiBlast_CBE 69.3543%-150 - C1 -4NAH 7.1 COAD_STAAW
122 HHSearch 68.4051%-150 - C1 -1OD6 3.2 COAD_THET8
62 PsiBlast_CBE 67.5143%-142 - C1 -4NAH 6.5 COAD_STAAW
58 PsiBlast_CBE 66.7143%-150 - C1 -4NAT 4.2 COAD_STAAW
63 PsiBlast_CBE 66.7043%-151 - C1 -4NAH 5.6 COAD_STAAW
64 PsiBlast_CBE 66.5643%-147 - C1 -4NAH 6.3 COAD_STAAW
128 HHSearch 65.2143%-151 - C1 -4NAT 4.2 COAD_STAAW
60 PsiBlast_CBE 64.5943%-151 - C1 -4NAT 4.2 COAD_STAAW
55 PsiBlast_CBE 64.0743%-149 - C1 -4NAU 7.1 COAD_STAAW
59 PsiBlast_CBE 63.0243%-150 - C1 -4NAT 3.6 COAD_STAAW
73 PsiBlast_CBE 62.1246%-149 - C1 -3OTW 9.5 COAD_HELPY
72 PsiBlast_CBE 61.4246%-150 - C1 -3OTW 8.2 COAD_HELPY
74 PsiBlast_CBE 61.4146%-153 - C1 -3OTW 8.8 COAD_HELPY
77 PsiBlast_CBE 60.9746%-157 - C1 -3OTW 9.6 COAD_HELPY
75 PsiBlast_CBE 60.2246%-151 - C1 -3OTW 8.8 COAD_HELPY
76 PsiBlast_CBE 60.0246%-154 - C1 -3OTW 9.1 COAD_HELPY
79 PsiBlast_CBE 52.7145%-205 - C1 -3NV7 3.5 COAD_HELPY
126 HHSearch 52.3742%-190 - C1 -3NV7 3.5 COAD_HELPY