@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTL6: (2017-12-14 )
MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMSHDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRMPEVTFWLDAPIELGMNRARERGALDRFEQEKLSFFTKVREGYETLWKAEPERIKRLDATQSPDQVFEQALQYLA

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

Z5A_A_2(5TMP)
KTHY_ECOLI
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




TMP_A_3(4E5U)
KTHY_PSEAE
[Raw transfer]




TMP_B_5(4E5U)
KTHY_PSEAE
[Raw transfer]




TYD_A_4(5H56)
?
[Raw transfer]




TMP_B_8(4EDH)
KTHY_PSEAE
[Raw transfer]




ATM_B_8(4GMD)
KTHY_PSEAE
[Raw transfer]




ATM_C_12(4GMD)
KTHY_PSEAE
[Raw transfer]




TYD_B_7(3HJN)
KTHY_THEMA
[Raw transfer]




ATM_D_15(4GMD)
KTHY_PSEAE
[Raw transfer]




TMP_B_8(4EDH)
KTHY_PSEAE
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




TYD_B_12(5H56)
?
[Raw transfer]




ATM_A_5(4GMD)
KTHY_PSEAE
[Raw transfer]




THM_A_4(3N2I)
KTHY_VIBCH
[Raw transfer]




TMP_B_4(5XB2)
?
[Raw transfer]




TMP_A_10(5XB2)
?
[Raw transfer]




TMP_A_3(4EDH)
KTHY_PSEAE
[Raw transfer]




TMP_A_4(5XB3)
?
[Raw transfer]




TMP_B_6(5XB3)
?
[Raw transfer]




TMP_A_3(4EDH)
KTHY_PSEAE
[Raw transfer]




TMP_B_9(4S35)
KTHY_AQUAE
[Raw transfer]




TMP_A_4(4S35)
KTHY_AQUAE
[Raw transfer]




T05_B_4(4HLC)
KTHY_STAAR
[Raw transfer]




0DN_C_11(3UXM)
KTHY_PSEAE
[Raw transfer]




THM_A_2(4ESH)
KTHY_PSEAE
[Raw transfer]




0DN_A_7(3UXM)
KTHY_PSEAE
[Raw transfer]




0DJ_B_4(3UWO)
KTHY_PSEAE
[Raw transfer]




TMP_A_6(5XAI)
?
[Raw transfer]




ATM_B_4(4EAQ)
KTHY_STAAM
[Raw transfer]




TMP_B_4(2CCG)
KTHY_STAAM
[Raw transfer]




0DJ_A_3(3UWO)
KTHY_PSEAE
[Raw transfer]




TMP_A_3(2CCG)
KTHY_STAAM
[Raw transfer]




ATM_A_3(4EAQ)
KTHY_STAAM
[Raw transfer]




TMP_B_4(5XAI)
?
[Raw transfer]




TMP_B_10(2CCJ)
KTHY_STAAM
[Raw transfer]




0DF_A_3(3UWK)
KTHY_PSEAE
[Raw transfer]




31Z_B_4(4QGA)
KTHY_STAAR
[Raw transfer]




THM_B_6(3N2I)
KTHY_VIBCH
[Raw transfer]




THM_B_6(3N2I)
KTHY_VIBCH
[Raw transfer]




0DF_B_5(3UWK)
KTHY_PSEAE
[Raw transfer]




0DN_D_12(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_B_8(3UXM)
KTHY_PSEAE
[Raw transfer]




TMP_A_6(2CCJ)
KTHY_STAAM
[Raw transfer]




C5P_B_11(5H5K)
?
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




C5P_A_8(5H5K)
?
[Raw transfer]




MRD_B_7(3V9P)
KTHY_BURTA
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




MRD_B_7(3V9P)
KTHY_BURTA
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




ADP_B_9(4EDH)
KTHY_PSEAE
[Raw transfer]




100 HHSearch 69.8548% -40 - C2 -4EDH 6.9 KTHY_PSEAE
101 HHSearch 67.5148% -39 - C2 -4EDH 6.5 KTHY_PSEAE
27 PsiBlast_CBE 66.8351% -37 - C2 -3UXM 6.1 KTHY_PSEAE
3 PsiBlast_PDB 66.6551% -46 - C2 -4GMD 7.0 KTHY_PSEAE
25 PsiBlast_CBE 66.5651% -33 - C2 -3UXM 5.9 KTHY_PSEAE
102 HHSearch 66.1138% -30 - C2 -4MQB - KTHY_STAAM -
1 PsiBlast_PDB 65.3551% -31 - C2 -4EDH 6.9 KTHY_PSEAE
29 PsiBlast_CBE 65.1351% -42 - C2 -3UWO 7.1 KTHY_PSEAE
2 PsiBlast_PDB 64.9551% -43 - C2 -4ESH 6.0 KTHY_PSEAE
24 PsiBlast_CBE 64.6151% -39 - C2 -4EDH 6.5 KTHY_PSEAE
5 PsiBlast_PDB 64.5851% -40 - C2 -3UWK 6.9 KTHY_PSEAE
6 PsiBlast_PDB 64.5651% -47 - C2 -3UWO 7.3 KTHY_PSEAE
28 PsiBlast_CBE 64.1551% -49 - C2 -3UWK 6.7 KTHY_PSEAE
21 PsiBlast_CBE 63.8651% -37 - C2 -4GMD 7.7 KTHY_PSEAE
23 PsiBlast_CBE 63.8551% -36 - C2 -4GMD 6.7 KTHY_PSEAE
117 HHSearch 63.7237% -39 - C2 -5H56 - ? -
61 PsiBlast_CBE 63.6837% -14 - C2 -5XAI 5.5 ?
116 HHSearch 63.5337% -32 - C2 -4S35 - KTHY_AQUAE -
7 PsiBlast_PDB 63.4350% -38 - C2 -4E5U 6.8 KTHY_PSEAE
35 PsiBlast_CBE 63.3338% -14 - C2 -4DWJ - KTHY_STAAM -
63 PsiBlast_CBE 63.3237% -15 - C2 -5H5K 4.3 ?
26 PsiBlast_CBE 63.2551% -40 - C2 -3UXM 5.9 KTHY_PSEAE
66 PsiBlast_CBE 63.2437% -18 - C2 -5H56 5.8 ?
52 PsiBlast_CBE 63.1837% -15 - C2 -2CCG 5.4 KTHY_STAAM
56 PsiBlast_CBE 63.1037% -11 - C2 -5XB3 5.5 ?
31 PsiBlast_CBE 63.0638% -19 - C2 -4EAQ 6.0 KTHY_STAAM
57 PsiBlast_CBE 63.0437% -16 - C2 -5XB3 5.0 ?
69 PsiBlast_CBE 62.8537% -10 - C2 -4S35 6.2 KTHY_AQUAE
60 PsiBlast_CBE 62.8337% -15 - C2 -5XAI 5.5 ?
59 PsiBlast_CBE 62.8237% -12 - C2 -5XB2 4.3 ?
67 PsiBlast_CBE 62.8137% -15 - C2 -5H56 6.8 ?
62 PsiBlast_CBE 62.7937% -17 - C2 -5H5K 4.2 ?
22 PsiBlast_CBE 62.7851% -48 - C2 -4GMD 7.1 KTHY_PSEAE
30 PsiBlast_CBE 62.7549% -35 - C2 -4E5U 6.8 KTHY_PSEAE
51 PsiBlast_CBE 62.6537% -19 - C2 -2CCG 5.1 KTHY_STAAM
58 PsiBlast_CBE 62.5937% -13 - C2 -5XB2 5.1 ?
68 PsiBlast_CBE 62.5437% -13 - C2 -4S35 5.9 KTHY_AQUAE
8 PsiBlast_PDB 62.4741% 24 - C2 -4TMK 11.6 KTHY_ECOLI
12 PsiBlast_PDB 62.3138% -20 - C2 -2CCJ 5.0 KTHY_STAAM
112 HHSearch 62.0538% -30 * C2 *3HJN 4.3 KTHY_THEMA
48 PsiBlast_CBE 62.0338% -16 - C2 -4HLC 7.3 KTHY_STAAR
45 PsiBlast_CBE 61.7738% -17 - C2 -4QGA 7.0 KTHY_STAAR
75 PsiBlast_CBE 61.6139% 7 - C2 -3V9P 3.0 KTHY_BURTA
50 PsiBlast_CBE 61.4538% -15 - C2 -2CCJ 4.9 KTHY_STAAM
11 PsiBlast_PDB 61.2638% -16 - C2 -4EAQ 5.9 KTHY_STAAM
105 HHSearch 61.2241% 14 - C2 -3V9P 3.0 KTHY_BURTA
4 PsiBlast_PDB 60.7851% -39 - C2 -3UXM 5.9 KTHY_PSEAE
9 PsiBlast_PDB 60.6641% 21 - C2 -5TMP 11.2 KTHY_ECOLI
114 HHSearch 60.4939% 27 - C2 -3N2I 3.5 KTHY_VIBCH
106 HHSearch 60.2041% 17 - C2 -3V9P 3.0 KTHY_BURTA
90 Fugue 59.8940% 29 - C2 -4TMK 11.7 KTHY_ECOLI
54 PsiBlast_CBE 59.7340% 28 - C2 -3N2I 4.3 KTHY_VIBCH
53 PsiBlast_CBE 59.5540% 29 - C2 -3N2I 3.5 KTHY_VIBCH
74 PsiBlast_CBE 59.5339% 14 - C2 -3V9P 3.0 KTHY_BURTA
113 HHSearch 59.2439% 22 - C2 -3LV8 6.3 KTHY_VIBCH
77 PsiBlast_CBE 58.5540% -11 - C2 -3HJN 5.6 KTHY_THEMA
55 PsiBlast_CBE 57.9440% 25 - C2 -3LV8 6.1 KTHY_VIBCH
76 PsiBlast_CBE 56.0140% -14 - C2 -3HJN 5.1 KTHY_THEMA