@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTX2: (2017-12-15 )
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSSEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_9(4IKO)
?
[Raw transfer]




GOL_A_9(4HOY)
?
[Raw transfer]




GOL_A_9(4HOY)
?
[Raw transfer]




GOL_A_9(4JY7)
?
[Raw transfer]




5AE_A_2(4QD3)
PTH_PSEAE
[Raw transfer]




3NZ_A_3(4QBK)
PTH_PSEAE
[Raw transfer]




PML_B_4(4DJJ)
PTH_PSEAE
[Raw transfer]




0L1_A_3(4DHW)
PTH_PSEAE
[Raw transfer]




PML_A_3(4DJJ)
PTH_PSEAE
[Raw transfer]




0L1_B_4(4DHW)
PTH_PSEAE
[Raw transfer]




0L1_B_4(4DHW)
PTH_PSEAE
[Raw transfer]




PEG_B_4(4ERX)
PTH_PSEAE
[Raw transfer]




GOL_B_8(4FNO)
PTH_PSEAE
[Raw transfer]




PEG_A_3(4ERX)
PTH_PSEAE
[Raw transfer]




URI_A_2(4JX9)
?
[Raw transfer]




CTN_A_2(4JWK)
?
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




TLA_A_3(4OLJ)
?
[Raw transfer]




BME_A_10(3KK0)
PTH_MYCS2
[Raw transfer]




37 HHSearch 96.4599% -98 - C4 -4LWR - ? -
9 PsiBlast_PDB 96.4599% -98 - C4 -4LWR - ? -
6 PsiBlast_PDB 95.9899%-101 - C4 -4JWK 3.5 ?
10 PsiBlast_PDB 95.9399% -96 - C4 -3WH4 - ? -
4 PsiBlast_PDB 95.8299%-102 - C4 -4IKO Error ?
7 PsiBlast_PDB 95.7999% -97 - C4 -4JX9 4.2 ?
36 HHSearch 95.7299%-102 - C4 -4HOY Error ?
3 PsiBlast_PDB 95.7299%-102 - C4 -4HOY Error ?
1 PsiBlast_PDB 95.6999%-104 - C4 -4FOP - ? -
5 PsiBlast_PDB 95.6799%-101 - C4 -4JY7 Error ?
11 PsiBlast_PDB 95.2798% -99 - C4 -4OLJ 2.7 ?
8 PsiBlast_PDB 94.9499% -97 - C4 -4LWQ - ? -
2 PsiBlast_PDB 94.8099%-102 - C4 -4FOT - ? -
39 HHSearch 79.4759% -64 - C4 -4DHW 3.2 PTH_PSEAE
24 PsiBlast_CBE 78.8358% -64 - C4 -4DHW 3.2 PTH_PSEAE
16 PsiBlast_PDB 78.3358% -63 - C4 -4JC4 - PTH_PSEAE -
23 PsiBlast_CBE 78.2758% -63 - C4 -4DJJ 3.2 PTH_PSEAE
15 PsiBlast_PDB 78.2458% -64 - C4 -4FNO - PTH_PSEAE -
12 PsiBlast_PDB 78.0858% -64 - C4 -4DHW 2.9 PTH_PSEAE
21 PsiBlast_CBE 77.8558% -62 - C4 -4FNO 3.0 PTH_PSEAE
13 PsiBlast_PDB 77.6658% -61 - C4 -4DJJ 2.9 PTH_PSEAE
18 PsiBlast_PDB 77.6558% -58 - C4 -4QBK 6.7 PTH_PSEAE
22 PsiBlast_CBE 77.1058% -63 - C4 -4ERX 2.9 PTH_PSEAE
14 PsiBlast_PDB 76.8658% -63 - C4 -4ERX 3.0 PTH_PSEAE
19 PsiBlast_PDB 76.7358% -61 - C4 -4QD3 4.1 PTH_PSEAE
32 PsiBlast_CBE 74.6643% -74 - C4 -3NEA 3.0 PTH_FRATT
50 HHSearch 74.0343% -74 - C4 -3NEA 3.0 PTH_FRATT
35 PsiBlast_CBE 69.7240% -57 - C4 -3KK0 2.8 PTH_MYCS2