@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTX3: (2017-12-15 )
MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIISVNGGAAHQADVGDLVIIATFGDFTEAEANAHKPRLVYANPDNTVNHTANCIPVQVA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMR_B_4(2EEO)
?
[Raw transfer]




GLU_B_5(4AON)
?
[Raw transfer]




GLU_E_6(4AON)
?
[Raw transfer]




FMR_B_4(2EEO)
?
[Raw transfer]




NSN_A_9(1UHE)
?
[Raw transfer]




2 PsiBlast_PDB 90.3757%-132 - C3 -4CRZ - ? -
1 PsiBlast_PDB 89.8057%-127 - C3 -4CS0 - PAND_ECOLI -
4 PsiBlast_PDB 87.8157%-131 - C3 -4AZD - ? -
3 PsiBlast_PDB 83.6557% - - C3 -1PQE - PAND_ECOLI -
5 PsiBlast_PDB 83.5857%-134 - C3 -1PT1 - PAND_ECOLI -
6 PsiBlast_PDB 80.0157% -26 - C3 -1PT0 - PAND_ECOLI -
7 PsiBlast_PDB 79.4557% -30 - C3 -1PYQ - PAND_ECOLI -
12 PsiBlast_PDB 74.4547%-126 - C3 -2C45 - PAND_MYCTU -
11 PsiBlast_PDB 74.0956%-141 - C3 -3TM7 - ? -
41 HHSearch 74.0744%-123 - C3 -2C45 - PAND_MYCTU -
43 HHSearch 74.0557%-145 - C3 -4CRY - ? -
8 PsiBlast_PDB 73.7556%-145 - C3 -4CRY - ? -
13 PsiBlast_PDB 72.4856%-140 - C3 -4AON 2.6 ?
9 PsiBlast_PDB 71.9757%-142 - C3 -4AOK - ? -
10 PsiBlast_PDB 71.6857%-154 - C3 -1PYU - PAND_ECOLI -
15 PsiBlast_PDB 71.0554%-151 - C3 -4D7Z - ? -
24 PsiBlast_CBE 70.2757%-153 - C3 -4AON 2.6 ?
42 HHSearch 70.0040%-125 - C3 -3OUG - PAND_FRATT -
14 PsiBlast_PDB 69.4457%-157 - C3 -1AW8 - ? -
19 PsiBlast_PDB 69.1840%-125 - C3 -3OUG - PAND_FRATT -