@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTY0: (2017-12-15 )
MRPTVLCFSGLDPSGGAGLQADIEAIGQSGAHAAIACTALTIQNSQQVFGSEATSKELLLAQANAVVGDLPIKCVKSGMLGTTDNIAALAEFLRAHPDYQYVLDPVLVANSGGSLGDQATLVKAFVELILLATLITPNTVELRALTGVTDLDQATQKLFEMGAKAVLVKGGHEDTPDFIKNSLYIDGELAASSTCPRLEGEYHGSGCSLASFIAGRLALGDSLKIAVQHAETWLFGVLKNAETPVPNGQKIPKRF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLP_A_2(4YWR)
?
[Raw transfer]




PLP_A_2(4YWR)
?
[Raw transfer]




HMH_H_8(1JXI)
THID_SALTY
[Raw transfer]




PXL_A_5(4C5N)
?
[Raw transfer]




EDO_A_3(4YL5)
?
[Raw transfer]




UEG_A_5(4C5L)
?
[Raw transfer]




HMH_G_7(1JXI)
THID_SALTY
[Raw transfer]




1 PsiBlast_PDB 98.0398%-115 - C4 -4YL5 2.3 ?
2 PsiBlast_PDB 96.2998%-112 - C4 -4YWR 4.3 ?
70 HHSearch 91.3998% -76 - C4 -4YWR 4.3 ?
74 HHSearch 68.2532% -66 - C4 -1JXI 3.2 THID_SALTY
5 PsiBlast_PDB 67.5535% -69 - C4 -1JXI 3.4 THID_SALTY
75 HHSearch 67.4832% -72 - C4 -1JXH - THID_SALTY -
22 PsiBlast_CBE 67.1335% -70 - C4 -1JXI - THID_SALTY -
4 PsiBlast_PDB 65.8635% -78 - C4 -1JXH - THID_SALTY -
61 HHSearch 63.6034% -52 * C4 *1UB0 - ? -
81 HHSearch 62.1433% -56 - C4 -3RM5 - THI20_YEAST -
3 PsiBlast_PDB 61.9632% -64 - C4 -4JJP - ? -
21 PsiBlast_CBE 61.8032% -69 - C4 -4JJP - ? -
80 HHSearch 61.2633% -61 - C4 -3RM5 - THI20_YEAST -
51 Fugue 60.3631% -25 - C4 -1JXH - THID_SALTY -
64 HHSearch 58.8224% -34 - C4 -3MBH - ? -
65 HHSearch 58.7024% -35 - C4 -3MBH - ? -
11 PsiBlast_PDB 55.5128% -18 - C4 -2I5B - PDXK_BACSU -
13 PsiBlast_PDB 55.4034% -51 - C4 -1UB0 - ? -
69 HHSearch 55.0325% -40 - C4 -3H74 - ? -
79 HHSearch 54.7821% -18 - C4 -4S1H - ? -