@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTY3: (2017-12-15 )
MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLTDSFGEQGAGLALDVRNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKRVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGGLYMA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

36P_C_6(4BO6)
FABG_PSEAE
[Raw transfer]




8M5_D_6(4BNZ)
FABG_PSEAE
[Raw transfer]




Q7U_D_6(4BNV)
FABG_PSEAE
[Raw transfer]




FXE_C_7(4BO0)
FABG_PSEAE
[Raw transfer]




8M5_A_5(4BNZ)
FABG_PSEAE
[Raw transfer]




O74_C_6(4BNX)
FABG_PSEAE
[Raw transfer]




34X_C_6(4BO8)
FABG_PSEAE
[Raw transfer]




36I_D_6(4BNY)
FABG_PSEAE
[Raw transfer]




9KQ_D_6(4BNU)
FABG_PSEAE
[Raw transfer]




O74_A_5(4BNX)
FABG_PSEAE
[Raw transfer]




WI4_B_5(4BO5)
FABG_PSEAE
[Raw transfer]




Q7U_B_5(4BNV)
FABG_PSEAE
[Raw transfer]




36G_C_6(4BO4)
FABG_PSEAE
[Raw transfer]




J2T_A_5(4BO7)
FABG_PSEAE
[Raw transfer]




36I_D_6(4BNY)
FABG_PSEAE
[Raw transfer]




36K_A_5(4BO2)
FABG_PSEAE
[Raw transfer]




J2T_C_6(4BO7)
FABG_PSEAE
[Raw transfer]




FXE_A_5(4BO0)
FABG_PSEAE
[Raw transfer]




36P_A_5(4BO6)
FABG_PSEAE
[Raw transfer]




U98_C_7(4BO3)
FABG_PSEAE
[Raw transfer]




6 PsiBlast_PDB 88.8258%-104 - C1 -3TZK - ? -
96 PsiBlast_CBE 88.1458%-103 - C1 -1Q7B - FABG_ECOLI -
26 PsiBlast_CBE 88.0058% -99 - C1 -4I08 - FABG_VIBCH -
100 PsiBlast_CBE 87.2558%-100 - C1 -1Q7C - FABG_ECOLI -
3 PsiBlast_PDB 86.7458% -97 - C1 -3RSH - FABG_VIBCH -
73 PsiBlast_CBE 86.5557% -63 - C1 -4BNY 3.3 FABG_PSEAE
95 PsiBlast_CBE 86.4258%-102 - C1 -1Q7B - FABG_ECOLI -
50 PsiBlast_CBE 85.8157% -62 - C1 -4BO6 4.2 FABG_PSEAE
28 PsiBlast_CBE 85.5858%-100 - C1 -3RRO - FABG_VIBCH -
7 PsiBlast_PDB 85.1258% -98 - C1 -3TZH - ? -
4 PsiBlast_PDB 84.8958% -97 - C1 -3RRO - FABG_VIBCH -
98 PsiBlast_CBE 84.7158% -97 - C1 -1Q7B - FABG_ECOLI -
71 PsiBlast_CBE 84.6057% -54 - C1 -4BNZ 3.1 FABG_PSEAE
69 PsiBlast_CBE 84.4757% -62 - C1 -4BNZ 3.9 FABG_PSEAE
97 PsiBlast_CBE 84.3558%-101 - C1 -1Q7B - FABG_ECOLI -
79 PsiBlast_CBE 84.2157% -56 - C1 -4BNW - FABG_PSEAE -
23 PsiBlast_CBE 83.8558%-114 - C1 -4WK6 - ? -
8 PsiBlast_PDB 83.8358% -98 - C1 -3U09 - FABG_VIBCH -
99 PsiBlast_CBE 83.5758% -98 * C1 *1Q7C - FABG_ECOLI -
67 PsiBlast_CBE 83.3257% -56 - C1 -4BO0 3.5 FABG_PSEAE
53 PsiBlast_CBE 81.3757% -52 - C1 -4BO5 4.7 FABG_PSEAE