@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VU02: (2017-12-16 )
MAITSVIEQMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPEFVQADSPTTKVGGQALSKFESVTHVVPMLSLGNVFNQEDLFAFARRVEERLPNQKVQYEVELKLDGLAISLWYENGVLVRGVTRGDGETGEDITQNVKTIRNLPKVLHSEKYEIPRLLEVRGEVLMPKSGFEKLNADQEAKGEKTFANPRNAAAGSLRQLDPNIAAARPLAFYAYGIAQCEPNHGLTTMHDSLQWLTELGFQIAERQYLCNSIQEVQQRYEQIQQERPNLQVEIDGMVVKVDDLKQQQQLGFLSREPRWATAYKFPAQAALTTVEQIDWQVGRTGTLTPVARLNPVFVGGVTVSNVTLHNIGEIHRLDVRIGDTVSVYRTGDVIPKVEKVWPEFRPAEAEVVHLPESCPVCASPVVMPEGEALARCSGGLYCAAQRIEAIRHFVSRKAMDIEGLGDRWVESLLRLDLLKDVADIYHLHEHRETLLGIEKMGEKSVQNLIDAIEASKKTTLARFIYALGIRGVGETTARMLANTFQTLEALKAANVEALKKTPDVGDITAEWIADFFLAPHNIEVLDRLIAAGIHWDAPTAPTRQPLNGESWVLTGTLEQMTRDQATQMLQALGARVSGSVSSKTKCVVAGEKAGSKLEKAAKLGIPVMNETDFLSLMAGYGQTLS

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3BA_A_7(3BAA)
DNLJ_ENTFA
[Raw transfer]




NAD_A_2(5TT5)
DNLJ_ECOLI
[Raw transfer]




NAD_A_2(5TT5)
DNLJ_ECOLI
[Raw transfer]




3BD_A_7(3BAB)
DNLJ_ENTFA
[Raw transfer]




IVH_A_2(3PN1)
DNLJ_HAEIN
[Raw transfer]




AMP_D_10(2OWO)
DNLJ_ECOLI
[Raw transfer]




IVH_A_2(3PN1)
DNLJ_HAEIN
[Raw transfer]




9MJ_A_3(4UCS)
DNLJ_HAEIN
[Raw transfer]




D41_A_2(4UCO)
DNLJ_HAEIN
[Raw transfer]




IA7_A_2(4UFZ)
DNLJ_HAEIN
[Raw transfer]




0OW_A_5(4EFB)
DNLJ_ENTFA
[Raw transfer]




3B8_A_6(3BA8)
DNLJ_ENTFA
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




3B9_A_5(3BAC)
DNLJ_HAEIN
[Raw transfer]




0OV_A_5(4EFE)
DNLJ_ENTFA
[Raw transfer]




0XS_A_7(4GLX)
DNLJ_ECOLI
[Raw transfer]




0XT_B_6(4GLW)
DNLJ_STRZP
[Raw transfer]




0XT_B_6(4GLW)
DNLJ_STRZP
[Raw transfer]




5U1_A_3(4UCT)
DNLJ_HAEIN
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




AMP_A_5(1DGS)
DNLJ_THEFI
[Raw transfer]




AMP_A_2(3SGI)
DNLJ_MYCTU
[Raw transfer]




0OX_A_5(4EEQ)
DNLJ_ENTFA
[Raw transfer]




GOL_A_8(3BA9)
DNLJ_ENTFA
[Raw transfer]




AMP_B_6(1V9P)
DNLJ_THEFI
[Raw transfer]




AMP_A_5(1V9P)
DNLJ_THEFI
[Raw transfer]




AMP_A_5(1DGS)
DNLJ_THEFI
[Raw transfer]




GOL_E_5(1TA8)
DNLJ_ENTFA
[Raw transfer]




AMP_B_6(1V9P)
DNLJ_THEFI
[Raw transfer]




L5Y_A_3(4CC6)
DNLJ_STAAU
[Raw transfer]




JCF_A_3(4UCR)
DNLJ_HAEIN
[Raw transfer]




1X8_A_2(4LH7)
DNLJ_ENTFA
[Raw transfer]




1X7_A_2(4LH6)
DNLJ_ENTFA
[Raw transfer]




1X7_A_2(4LH6)
DNLJ_ENTFA
[Raw transfer]




AMP_B_6(1DGS)
DNLJ_THEFI
[Raw transfer]




L5V_A_3(4CC5)
DNLJ_STAAU
[Raw transfer]




I6G_A_3(4UCV)
DNLJ_HAEIN
[Raw transfer]




10L_A_2(5FPO)
DNLJ_STAAU
[Raw transfer]




8HC_A_2(4UCU)
DNLJ_HAEIN
[Raw transfer]




NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

46 HHSearch 84.3752%-111 - C8 -4GLX 4.2 DNLJ_ECOLI
3 PsiBlast_PDB 84.3751%-110 - C8 -4GLX 6.7 DNLJ_ECOLI
44 HHSearch 83.2152% -98 - C8 -5TT5 11.5 DNLJ_ECOLI
2 PsiBlast_PDB 82.7651% -98 - C8 -5TT5 11.5 DNLJ_ECOLI
1 PsiBlast_PDB 75.5751% 1 - C8 -2OWO 6.2 DNLJ_ECOLI
21 PsiBlast_CBE 70.0245% 12 - C8 -1DGS 5.5 DNLJ_THEFI
66 Fugue 69.9145% 15 - C8 -1DGS 5.0 DNLJ_THEFI
5 PsiBlast_PDB 69.8447% 13 - C8 -1V9P 4.2 DNLJ_THEFI
22 PsiBlast_CBE 69.4547% 16 - C8 -1V9P 4.9 DNLJ_THEFI
4 PsiBlast_PDB 69.2845% 14 - C8 -1DGS 5.0 DNLJ_THEFI
45 HHSearch 68.3346% 22 - C8 -1V9P 4.7 DNLJ_THEFI
52 HHSearch 56.6046% -78 - C8 -4LH6 4.6 DNLJ_ENTFA
32 PsiBlast_CBE 56.4545% -77 - C8 -4LH6 4.6 DNLJ_ENTFA
30 PsiBlast_CBE 56.2845% -75 - C8 -4EEQ 5.0 DNLJ_ENTFA
18 PsiBlast_PDB 56.2845% -80 - C8 -3BA8 6.3 DNLJ_ENTFA
29 PsiBlast_CBE 56.0945% -76 - C8 -4EFB 6.5 DNLJ_ENTFA
27 PsiBlast_CBE 55.8645% -75 - C8 -1TA8 2.3 DNLJ_ENTFA
28 PsiBlast_CBE 55.8045% -77 - C8 -4EFE 7.0 DNLJ_ENTFA
19 PsiBlast_PDB 55.7745% -77 - C8 -3BA9 3.1 DNLJ_ENTFA
48 HHSearch 55.6248% -71 - C8 -1B04 - DNLJ_GEOSE -
31 PsiBlast_CBE 55.5445% -74 - C8 -4LH7 4.3 DNLJ_ENTFA
20 PsiBlast_PDB 55.5345% -74 - C8 -3BAA 7.9 DNLJ_ENTFA
23 PsiBlast_CBE 55.4645% -73 - C8 -3BAB 8.2 DNLJ_ENTFA
11 PsiBlast_PDB 52.5750% -2 - C8 -4UCU 4.3 DNLJ_HAEIN
15 PsiBlast_PDB 52.5250% -7 - C8 -3PN1 7.0 DNLJ_HAEIN
49 HHSearch 52.4851% 9 - C8 -3UQ8 6.4 DNLJ_HAEIN
35 PsiBlast_CBE 52.4445% -59 - C8 -4CC6 7.0 DNLJ_STAAU
9 PsiBlast_PDB 52.4150% -4 - C8 -4UCS 5.4 DNLJ_HAEIN
53 HHSearch 52.0245% -71 * C8 *4GLW 4.5 DNLJ_STRZP
14 PsiBlast_PDB 51.9450% 1 - C8 -3UQ8 6.4 DNLJ_HAEIN
13 PsiBlast_PDB 51.7650% -2 - C8 -4UFZ 6.7 DNLJ_HAEIN
36 PsiBlast_CBE 51.6145% -60 - C8 -4CC5 4.2 DNLJ_STAAU
51 HHSearch 51.4651% 8 - C8 -3PN1 7.0 DNLJ_HAEIN
10 PsiBlast_PDB 51.2950% -2 - C8 -4UCT 5.2 DNLJ_HAEIN
8 PsiBlast_PDB 51.1850% -3 - C8 -4UCR 6.0 DNLJ_HAEIN
34 PsiBlast_CBE 51.1745% -64 - C8 -5FPO 2.9 DNLJ_STAAU
39 PsiBlast_CBE 51.0444% -70 - C8 -4GLW 4.5 DNLJ_STRZP
7 PsiBlast_PDB 50.8450% -2 - C8 -4UCO 6.8 DNLJ_HAEIN
12 PsiBlast_PDB 50.3850% -2 - C8 -4UCV 4.7 DNLJ_HAEIN
42 PsiBlast_CBE 47.1143% -1 - C8 -1ZAU 4.9 DNLJ_MYCTU
6 PsiBlast_PDB 46.7740% 13 - C8 -3SGI 5.0 DNLJ_MYCTU
50 HHSearch 46.6843% -1 - C8 -1ZAU 4.9 DNLJ_MYCTU
41 PsiBlast_CBE 44.3550% -7 - C8 -3BAC 8.5 DNLJ_HAEIN