@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VU92: (2017-12-17 )
MSLSPKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVQTAAEDGLSFGAPTVHETTLADIICEIMPSIELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLLVKAGSGLLTKGEGEPTSKGVPADFAKHTLTLPYNDIPALKECFAKFGHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVALGGAQSVYNVKPDLTTLGKIIGAGLPVGAFGGKREIMECIAPLGGVYQAGTLSGNPLAMRAGIEMFKHLRQPDFYNKLSVQLEKLLAGLQAAADEAGIPFKTQQAGAMFGLYFTDQEDITSFDSMLACDIEAFKKFFHGMLKRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PXG_A_3(3FQ7)
GSA_SYNP6
[Raw transfer]




PXG_B_4(3FQ7)
GSA_SYNP6
[Raw transfer]




PXG_B_4(3FQ7)
GSA_SYNP6
[Raw transfer]




KE4_A_3(2HP2)
GSA_SYNP6
[Raw transfer]




EA5_A_3(2HP1)
GSA_SYNP6
[Raw transfer]




PMP_A_3(5HDM)
GSA1_ARATH
[Raw transfer]




PMP_E_5(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_B_4(2HOZ)
GSA_SYNP6
[Raw transfer]




PLK_A_4(4AO4)
?
[Raw transfer]




PMP_A_3(5HDM)
GSA1_ARATH
[Raw transfer]




PMP_A_3(2GSA)
GSA_SYNP6
[Raw transfer]




PMP_A_2(3BS8)
GSA_BACSU
[Raw transfer]




PMP_A_3(2GSA)
GSA_SYNP6
[Raw transfer]




PMP_B_5(3FQA)
GSA_SYNP6
[Raw transfer]




IK2_B_5(4AOA)
BFAT_VARPD
[Raw transfer]




PMP_A_3(3FQA)
GSA_SYNP6
[Raw transfer]




PMP_A_3(3FQ8)
GSA_SYNP6
[Raw transfer]




PLK_C_12(4AO4)
?
[Raw transfer]




IK2_A_3(4AOA)
BFAT_VARPD
[Raw transfer]




PMP_C_3(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_B_4(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_C_8(2ZSM)
GSA_AERPE
[Raw transfer]




PMP_B_6(2ZSM)
GSA_AERPE
[Raw transfer]




PMP_A_4(2E7U)
GSA_THET8
[Raw transfer]




PLR_A_3(3USF)
GSA_SYNE7
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_A_2(2ZSL)
GSA_AERPE
[Raw transfer]




PMP_A_4(2ZSM)
GSA_AERPE
[Raw transfer]




PLP_A_3(4GSA)
GSA_SYNP6
[Raw transfer]




PLR_B_5(3USF)
GSA_SYNE7
[Raw transfer]




PLP_B_4(4GSA)
GSA_SYNP6
[Raw transfer]




PMP_A_4(2ZSM)
GSA_AERPE
[Raw transfer]




PLP_B_11(2YKY)
?
[Raw transfer]




PLP_B_4(2GSA)
GSA_SYNP6
[Raw transfer]




PLP_A_5(2YKY)
?
[Raw transfer]




PLP_B_4(2HP2)
GSA_SYNP6
[Raw transfer]




PLP_B_4(5HDM)
GSA1_ARATH
[Raw transfer]




PLR_A_3(2CFB)
GSA_THEEB
[Raw transfer]




PLP_B_4(2HP1)
GSA_SYNP6
[Raw transfer]




PLP_C_21(2YKY)
?
[Raw transfer]




PLP_C_17(2YKU)
?
[Raw transfer]




PPE_C_3(1WKH)
LYSJ_THET8
[Raw transfer]




GAB_D_4(3GSB)
GSA_SYNP6
[Raw transfer]




GAB_A_4(3FQA)
GSA_SYNP6
[Raw transfer]




HOZ_B_5(2HP2)
GSA_SYNP6
[Raw transfer]




HOZ_B_5(2HP1)
GSA_SYNP6
[Raw transfer]




EDO_C_12(2YKX)
?
[Raw transfer]




21 PsiBlast_CBE 96.2563%-104 - C2 -5I92 - GSA_PSEAE -
106 HHSearch 95.9164%-105 - C2 -5I92 - GSA_PSEAE -
1 PsiBlast_PDB 95.3363%-104 - C2 -5I92 - GSA_PSEAE -
7 PsiBlast_PDB 91.6053%-104 - C2 -2HOZ - GSA_SYNP6 -
10 PsiBlast_PDB 90.3853% -96 - C2 -3FQ7 5.6 GSA_SYNP6
30 PsiBlast_CBE 88.9653% -96 * C2 *3FQ7 5.9 GSA_SYNP6
9 PsiBlast_PDB 88.8353% -98 - C2 -2HP2 5.1 GSA_SYNP6
4 PsiBlast_PDB 88.6653% -93 - C2 -4GSA 3.1 GSA_SYNP6
12 PsiBlast_PDB 88.6453% -97 - C2 -3FQA 4.2 GSA_SYNP6
13 PsiBlast_PDB 88.5753% -97 - C2 -3FQ8 4.9 GSA_SYNP6
22 PsiBlast_CBE 88.3553% -95 - C2 -4GSA 3.2 GSA_SYNP6
31 PsiBlast_CBE 88.2953% -95 - C2 -3FQA 4.2 GSA_SYNP6
8 PsiBlast_PDB 88.2453% -97 - C2 -2HP1 5.3 GSA_SYNP6
11 PsiBlast_PDB 88.1353% -94 - C2 -3USF 4.4 GSA_SYNE7
3 PsiBlast_PDB 88.1053% -92 - C2 -2GSA 5.1 GSA_SYNP6
27 PsiBlast_CBE 88.0953%-100 - C2 -2HOZ 4.4 GSA_SYNP6
24 PsiBlast_CBE 88.0853% -97 - C2 -2GSA 3.5 GSA_SYNP6
25 PsiBlast_CBE 87.9053% -96 - C2 -2HP2 3.7 GSA_SYNP6
118 Fugue 87.8453% -90 - C2 -2GSA 5.1 GSA_SYNP6
5 PsiBlast_PDB 87.7653% -97 - C2 -3GSB 4.3 GSA_SYNP6
32 PsiBlast_CBE 87.6753% -97 - C2 -3FQ8 4.0 GSA_SYNP6
101 HHSearch 87.5953% -91 - C2 -3FQ7 5.9 GSA_SYNP6
2 PsiBlast_PDB 87.4455% -89 - C2 -3BS8 3.8 GSA_BACSU
23 PsiBlast_CBE 86.6553% -93 - C2 -3GSB 4.8 GSA_SYNP6
29 PsiBlast_CBE 86.1053%-107 - C2 -3USF 4.3 GSA_SYNE7
26 PsiBlast_CBE 85.8053%-104 - C2 -2HP1 3.0 GSA_SYNP6
33 PsiBlast_CBE 84.4750%-100 - C2 -5HDM 3.7 GSA1_ARATH
16 PsiBlast_PDB 84.1850% -96 - C2 -5HDM 4.1 GSA1_ARATH
111 HHSearch 82.5150% -91 - C2 -5HDM 4.1 GSA1_ARATH
35 PsiBlast_CBE 82.4842%-109 - C2 -2ZSM 4.1 GSA_AERPE
14 PsiBlast_PDB 81.8552% -75 - C2 -2E7U 4.3 GSA_THET8
17 PsiBlast_PDB 80.9342%-105 - C2 -2EPJ 4.8 GSA_AERPE
19 PsiBlast_PDB 80.8442%-104 - C2 -2ZSM 4.3 GSA_AERPE
34 PsiBlast_CBE 80.8242%-105 - C2 -2ZSM 4.2 GSA_AERPE
18 PsiBlast_PDB 80.7142%-105 - C2 -2ZSL 4.8 GSA_AERPE
15 PsiBlast_PDB 80.4852%-113 - C2 -2CFB 2.8 GSA_THEEB
98 HHSearch 76.7942% -91 - C2 -2EPJ 4.8 GSA_AERPE
97 HHSearch 76.3242% -89 - C2 -2ZSM 4.3 GSA_AERPE
57 PsiBlast_CBE 54.9832% -26 - C2 -2YKX 3.2 ?
54 PsiBlast_CBE 54.8232% -24 - C2 -2YKY 4.3 ?
63 PsiBlast_CBE 54.5332% -24 - C2 -2YKU 2.9 ?
56 PsiBlast_CBE 53.2132% -24 - C2 -2YKY 4.0 ?
55 PsiBlast_CBE 52.1332% -23 - C2 -2YKY 4.3 ?