@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VUQ9: (2017-12-19 )
MTTLKNDRFLRALLREPVDTTPIWMMRQAGRYLPEYRETRSKAGDFLSLCKNTEFACEVTLQPLRRYDLDAAILFSDILTIPDALGLGLYFETGEGPKFHKTVRTEQDVANLPKLNAKADLDYVMNAVSTIRSALGGQVPLIGFSGSPWTLATYMVEGGSSKEFRFTKQMMYAQPEVLHALLDHLADSVIDYLNAQIDAGAQAIQIFDSWGGALAHREYVEFSLNYMNKIIAGLQREKDGRRIPVIVFTKGGGQWLEPMITTGADALGLDWTTPLNTARNVVSGRVALQGNLDPAVLYGSAASIEKAVKAMLDDAYANGEKTGYVANLGHGITQWVDPAQPKIFVDTVHEYSAKYLG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1CP_A_2(1R3Q)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3W)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3Y)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3S)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(2Q71)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3S)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3T)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3V)
DCUP_HUMAN
[Raw transfer]




EDO_B_10(4ZR8)
?
[Raw transfer]




EDO_B_10(4ZR8)
?
[Raw transfer]




EDO_A_5(4ZR8)
?
[Raw transfer]




1 PsiBlast_PDB 98.4498%-116 - C1 -4ZR8 2.9 ?
21 PsiBlast_CBE 96.7698%-111 - C1 -4ZR8 2.0 ?
3 PsiBlast_PDB 86.5766%-113 - C1 -3CYV - DCUP_SHIFL -
35 HHSearch 79.7093% -20 - C1 -4ZR8 2.0 ?
2 PsiBlast_PDB 77.6067% -36 - C1 -4WSH - DCUP_PSEAE -
38 HHSearch 76.6657% -52 - C1 -4EXQ - DCUP_BURTA -
4 PsiBlast_PDB 75.9460% -41 - C1 -4EXQ - DCUP_BURTA -
24 Fugue 75.7635%-116 - C1 -1J93 - DCUP_TOBAC -
34 HHSearch 75.0864% -24 - C1 -4WSH - DCUP_PSEAE -
13 PsiBlast_PDB 69.9347% -39 - C1 -1R3V 8.0 DCUP_HUMAN
5 PsiBlast_PDB 69.7447% -39 - C1 -3GW0 - DCUP_HUMAN -
8 PsiBlast_PDB 69.6947% -39 - C1 -1R3Q 11.0 DCUP_HUMAN
36 HHSearch 69.6663% -15 - C1 -3CYV - DCUP_SHIFL -
6 PsiBlast_PDB 69.6647% -39 - C1 -3GW3 - DCUP_HUMAN -
23 PsiBlast_CBE 69.6347% -39 - C1 -2Q71 11.6 DCUP_HUMAN
9 PsiBlast_PDB 69.2947% -39 - C1 -1R3Y 11.0 DCUP_HUMAN
16 PsiBlast_PDB 69.2447% -37 - C1 -1R3W 10.4 DCUP_HUMAN
20 PsiBlast_PDB 69.0747% -39 - C1 -1R3T 9.2 DCUP_HUMAN
19 PsiBlast_PDB 69.0147% -38 - C1 -1R3S 11.6 DCUP_HUMAN
7 PsiBlast_PDB 68.5647% -37 - C1 -1URO - DCUP_HUMAN -
40 HHSearch 67.8345% -28 * C1 *1R3S 11.7 DCUP_HUMAN