@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TY96: (2017-12-14 )
MKAADSVFISKTNIRREEMKKLVVGILILASFGLAACGNSNNTSQADTKKSSTQTETTLTITDSNGDQIEVPNNPEKVVVFDNGSLDTMDALGVGDKVVGAATSSLPEYLSSYKKVESAGGIKEPDLEKINQLQPDLIIISGRQRDFQKDLSQIAPTIFLSLDAKNPWESFQQNVTALGEIFGKQEEAKTQLEELSSAIDQTKKKAEATDKKALVTLVNEGQLSAYGSGSRFGFIHDLFGFEQADDQIEASTHGQSVSYEYVLEKNPDILFVVDRTKAIGGDDSKDDISANELVAQTNAGKNQQIISLEPDVWYLSGGGLESMKLMIEDVNQAFK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EHS_B_9(5ADW)
?
[Raw transfer]




EHS_B_11(5ADV)
?
[Raw transfer]




PXJ_A_3(5A5V)
?
[Raw transfer]




5LC_A_3(5A5D)
?
[Raw transfer]




8LC_A_3(5AD1)
?
[Raw transfer]




EHS_A_5(5ADW)
?
[Raw transfer]




LCM_A_3(5A1J)
?
[Raw transfer]




5LC_C_9(5TCY)
?
[Raw transfer]




ECA_B_4(2CHU)
?
[Raw transfer]




ECA_B_5(2CHU)
?
[Raw transfer]




13 PsiBlast_PDB 96.8145% -88 - C1 -5LWQ - ? -
25 PsiBlast_CBE 96.4545% -82 - C1 -5ADV 5.1 ?
33 HHSearch 96.4045% -83 - C1 -5AD1 - ? -
6 PsiBlast_PDB 95.6645% -85 - C1 -5ADV - ? -
3 PsiBlast_PDB 95.5245% -83 - C1 -5AD1 6.5 ?
10 PsiBlast_PDB 95.2845% -85 - C1 -5LWH - ? -
7 PsiBlast_PDB 95.1045% -82 - C1 -5ADW 4.7 ?
8 PsiBlast_PDB 94.9445% -80 - C1 -5A5D 5.1 ?
23 PsiBlast_CBE 94.7745% -80 - C1 -5ADW 5.3 ?
22 PsiBlast_CBE 94.7345% -81 - C1 -5ADW - ? -
26 PsiBlast_CBE 94.6445% -80 - C1 -5TCY 5.5 ?
14 PsiBlast_PDB 94.4245% -81 - C1 -5TCY - ? -
27 PsiBlast_CBE 94.0745% -81 - C1 -5TCY - ? -
21 PsiBlast_CBE 93.8545% -81 - C1 -2CHU 3.4 ?
12 PsiBlast_PDB 93.7145% -83 - C1 -5MBQ - ? -
4 PsiBlast_PDB 93.6045% -80 - C1 -5A1J 6.0 ?
9 PsiBlast_PDB 92.9845% -81 - C1 -5A5V 5.8 ?
15 PsiBlast_PDB 92.9744% -87 - C1 -5MBU - ? -
2 PsiBlast_PDB 92.8045% -81 - C1 -2CHU 2.8 ?
49 Fugue 92.6043% -79 * C1 *2CHU - ? -