@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYC7: (2017-12-14 )
MYEYLTGVVTFINPYYIVVETNGIGYQIALGNPYRYSSKLNQKIKIYVHQVIREDAHLLYGFDSLEEKQLFLRLVSVSGIGPKSALGNHGKRRPLRFDSSSRIQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_2(1C7Y)
RUVA_ECOLI
[Raw transfer]

-

GOL_A_4(2ZTD)
RUVA_MYCTU
[Raw transfer]




GOL_K_11(2H5X)
RUVA_MYCTU
[Raw transfer]




NACID_B_1(1C7Y)
RUVA_ECOLI
[Raw transfer]

-

2 PsiBlast_PDB 80.2735% - - C1 -1BDX - RUVA_ECOLI -
36 HHSearch 70.2231% -89 - C1 -1CUK - RUVA_ECOLI -
38 HHSearch 69.9728%-142 - C1 -1BVS - RUVA_MYCLE -
40 HHSearch 69.4826%-162 - C1 -2ZTD 2.0 RUVA_MYCTU
39 HHSearch 69.3526%-166 * C1 *2H5X 3.1 RUVA_MYCTU
25 PsiBlast_CBE 68.7431%-184 - C1 -2ZTC - RUVA_MYCTU -
37 HHSearch 68.6831% -89 - C1 -1C7Y 2.8 RUVA_ECOLI
20 PsiBlast_CBE 67.7431%-197 - C1 -2H5X - RUVA_MYCTU -
10 PsiBlast_PDB 67.6631%-194 - C1 -2ZTE - RUVA_MYCTU -
1 PsiBlast_PDB 67.6135%-104 - C1 -1CUK - RUVA_ECOLI -
9 PsiBlast_PDB 67.5431%-187 - C1 -2ZTD - RUVA_MYCTU -
8 PsiBlast_PDB 67.5331%-181 - C1 -2ZTC - RUVA_MYCTU -
4 PsiBlast_PDB 67.3435%-111 - C1 -1HJP - RUVA_ECOLI -
7 PsiBlast_PDB 67.2831%-195 - C1 -2H5X - RUVA_MYCTU -
23 PsiBlast_CBE 67.2731%-183 - C1 -2ZTC - RUVA_MYCTU -
21 PsiBlast_CBE 67.1831%-190 - C1 -2H5X - RUVA_MYCTU -
22 PsiBlast_CBE 67.0231%-184 - C1 -2ZTD - RUVA_MYCTU -
19 PsiBlast_CBE 66.6031%-188 - C1 -2H5X - RUVA_MYCTU -
5 PsiBlast_PDB 66.4135%-105 - C1 -1D8L - RUVA_ECOLI -
3 PsiBlast_PDB 66.3935%-106 - C1 -1C7Y - RUVA_ECOLI -