@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYC8: (2017-12-14 )
MPLAIMASEDHSGLIQAVESSDVTYLTKFPGVGKKTAQQMILDLKGKFGELSIDTPFSLFDEANTKDATALSEAMEALSALGYSDREIKRVEKQLKEVDNQTTDEYLRQALKLMMKK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_1(1C7Y)
RUVA_ECOLI
[Raw transfer]

-

IMD_D_14(3VDP)
RECR_CALS4
[Raw transfer]




IMD_B_10(3VDP)
RECR_CALS4
[Raw transfer]




23 PsiBlast_CBE 81.4634% - - C2 -1BDX - RUVA_ECOLI -
22 PsiBlast_CBE 81.4634% - - C2 -1BDX - RUVA_ECOLI -
21 PsiBlast_CBE 81.4634% - - C2 -1BDX - RUVA_ECOLI -
1 PsiBlast_PDB 81.4634% - - C2 -1BDX - RUVA_ECOLI -
38 HHSearch 77.6632% -54 - C2 -1C7Y Error RUVA_ECOLI
2 PsiBlast_PDB 75.9434% -42 - C2 -1C7Y - RUVA_ECOLI -
35 HHSearch 72.5431%-112 - C2 -2ZTD - RUVA_MYCTU -
34 HHSearch 72.2531%-110 - C2 -2H5X - RUVA_MYCTU -
7 PsiBlast_PDB 72.2129%-102 - C2 -2ZTD - RUVA_MYCTU -
5 PsiBlast_PDB 70.8829% -99 - C2 -2H5X - RUVA_MYCTU -
6 PsiBlast_PDB 70.6229%-121 - C2 -2ZTC - RUVA_MYCTU -
3 PsiBlast_PDB 67.1934% -6 - C2 -1HJP - RUVA_ECOLI -
39 HHSearch 66.3427% -75 - C2 -1IXR - RUVA_THET8 -
36 HHSearch 66.0131% -7 - C2 -1CUK - RUVA_ECOLI -
4 PsiBlast_PDB 65.6233% 9 - C2 -1CUK - RUVA_ECOLI -
37 HHSearch 63.9629%-118 - C2 -1BVS - RUVA_MYCLE -
8 PsiBlast_PDB 58.4529% -32 - C2 -1BVS - RUVA_MYCLE -
9 PsiBlast_PDB 57.5439%-186 - C2 -1D8L - RUVA_ECOLI -
41 HHSearch 50.7127% -76 - C2 -1IXS - -
10 PsiBlast_PDB 50.3231%-152 - C2 -1IXR - RUVA_THET8 -
42 HHSearch 43.3936%-201 * C2 *3VDP 3.9 RECR_CALS4
43 HHSearch 41.6636%-214 - C2 -3VDP 3.5 RECR_CALS4