@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYD8: (2017-12-14 )
MNEKIIEIKHLRKSFGENEVLKDISVTVNKGEVVTIIGSSGSGKSTFLRCINLLEKPTGGEIIYNGENVLAPKYNLPKYRTNLGMVFQSFNLFNNMNVLENCMSGQTTVLKRDKETAKKVAIENLEKVGMDRYIEAKPAQLSGGQKQRVAIARALSMNPDVLLFDEPTSALDPEMVGEVLNTIKDLAHTGLTMLIVTHEMEFAKDVSDRVIFMDKGVIAEEGTPEDIFVHPKEERTKEFLSRILNA

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_6(4YMV)
?
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ACP_A_4(4AYT)
ABCBA_HUMAN
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




ACP_A_4(4AYX)
ABCBA_HUMAN
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




4 PsiBlast_PDB 96.3058%-120 - C1 -4YMV 5.4 ?
6 PsiBlast_PDB 95.4958%-122 - C1 -2OLJ 5.8 ?
30 PsiBlast_CBE 94.7758%-111 - C1 -2OLK 6.0 ?
28 PsiBlast_CBE 94.4158%-114 - C1 -2OLK 6.0 ?
29 PsiBlast_CBE 94.3558%-117 - C1 -2OLK 6.1 ?
8 PsiBlast_PDB 94.3058%-117 - C1 -2OUK - ? -
7 PsiBlast_PDB 93.8858%-118 - C1 -2OLK 6.0 ?
1 PsiBlast_PDB 93.8458%-120 - C1 -4YMS - ? -
9 PsiBlast_PDB 93.8258%-114 - C1 -2Q0H 5.5 ?
11 PsiBlast_PDB 93.7858%-108 - C1 -3C41 6.2 ?
21 PsiBlast_CBE 93.6358%-120 - C1 -4YMV 5.3 ?
32 PsiBlast_CBE 93.5058%-116 - C1 -3C41 5.8 ?
5 PsiBlast_PDB 93.4158%-118 - C1 -4YMW - ? -
23 PsiBlast_CBE 93.0658%-117 - C1 -3C4J 5.1 ?
12 PsiBlast_PDB 92.6455%-106 - C1 -4U00 5.9 ?
22 PsiBlast_CBE 92.5758%-124 - C1 -4YMU 6.1 ?
10 PsiBlast_PDB 92.5658%-112 - C1 -3C4J 6.7 ?
2 PsiBlast_PDB 91.8758%-120 - C1 -4YMT - ? -
24 PsiBlast_CBE 91.1058%-119 - C1 -2Q0H 5.9 ?
3 PsiBlast_PDB 91.0958%-119 - C1 -4YMU 6.4 ?
31 PsiBlast_CBE 90.6258%-114 - C1 -2OLJ 5.7 ?
14 PsiBlast_PDB 79.1253% -9 - C1 -1B0U 6.1 HISP_SALTY
127 Fugue 67.7252% 10 - C1 -1B0U 5.7 HISP_SALTY
86 PsiBlast_CBE 67.6535%-106 - C1 -3FVQ 7.7 FBPC_NEIG1
87 PsiBlast_CBE 65.8335%-107 - C1 -3FVQ 7.1 FBPC_NEIG1
132 HHSearch 65.1433%-101 - C1 -3FVQ 8.5 FBPC_NEIG1
111 PsiBlast_CBE 38.7232% -25 - C1 -2FGJ 5.7
98 PsiBlast_CBE 37.3333% -32 - C1 -2FF7 5.4
101 PsiBlast_CBE 36.9032% -21 - C1 -2FGK 6.2
104 PsiBlast_CBE 36.2032% -29 - C1 -2FGK 6.4 HLYBP_ECOLX
119 PsiBlast_CBE 35.8532% -28 - C1 -1XEF 5.0 HLYBP_ECOLX
115 PsiBlast_CBE 35.4932% -27 - C1 -2FFA 5.4
103 PsiBlast_CBE 35.4232% -21 - C1 -2FGK 6.2 HLYBP_ECOLX
102 PsiBlast_CBE 35.0032% -28 - C1 -2FGK 5.8 HLYBP_ECOLX