@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYE1: (2017-12-14 )
MKQLTVDEAAKEILAYQQITFLTGAGVSTPSGVPDYRSLSGIYHGMEQPEYLLSHQAMVNEPDKFYQFVKKIYHPEAKPNIIHLEIAHLAKEKNVWVVSQNIDGLHAKAKSPQLVNFHGSLYQCHCRKCQQTVDWKEYLHSDKHQACGGQIRPDIVLYGEGFQDGVMEQAAYAVSQAELIVIVGTSFQVHPFCDLVQFRQPSAKILVINQTPVYLAEPYTFIQEDGAVVFKKIQELGADYD

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DZD_A_4(3D4B)
NPD_THEMA
[Raw transfer]




CNA_A_3(4FVT)
SIR3_HUMAN
[Raw transfer]




OAD_A_5(4BVH)
SIR3_HUMAN
[Raw transfer]




OAD_B_17(4BVG)
SIR3_HUMAN
[Raw transfer]




AR6_A_3(4BVB)
SIR3_HUMAN
[Raw transfer]




AR6_A_4(4BN4)
SIR3_HUMAN
[Raw transfer]




APR_A_7(2H59)
NPD_THEMA
[Raw transfer]




NAD_A_2(4BV3)
SIR3_HUMAN
[Raw transfer]




1NQ_A_3(4JSR)
SIR3_HUMAN
[Raw transfer]




1NS_A_3(4JT9)
SIR3_HUMAN
[Raw transfer]




1NR_A_3(4JT8)
SIR3_HUMAN
[Raw transfer]




GOL_A_8(4BVG)
SIR3_HUMAN
[Raw transfer]




NCA_A_4(2H4J)
NPD_THEMA
[Raw transfer]




OCZ_A_3(4BUZ)
NPD_THEMA
[Raw transfer]




GOL_A_6(4KXQ)
SIR1_HUMAN
[Raw transfer]




NCA_A_4(1YC5)
NPD_THEMA
[Raw transfer]




OCZ_A_6(4BV2)
NPD_THEMA
[Raw transfer]




BVB_A_4(4C7B)
SIR3_HUMAN
[Raw transfer]




DMS_A_9(5MAR)
SIR2_HUMAN
[Raw transfer]




NCA_A_6(2HJH)
SIR2_YEAST
[Raw transfer]




MCM_B_4(5BWL)
SIR5_HUMAN
[Raw transfer]




BBI_A_3(4O8Z)
SIR3_HUMAN
[Raw transfer]




PEG_A_15(4BVG)
SIR3_HUMAN
[Raw transfer]




EDO_C_19(4BVH)
SIR3_HUMAN
[Raw transfer]




72 HHSearch 86.3327% -39 - C3 -2H59 - NPD_THEMA -
83 HHSearch 84.1326% -38 - C3 -2HJH - SIR2_YEAST -
79 HHSearch 83.8028% -38 - C3 -1M2K - NPD1_ARCFU -
81 HHSearch 81.8830% -12 - C3 -4BN4 - SIR3_HUMAN -
80 HHSearch 81.8128% -35 - C3 -1M2N - NPD1_ARCFU -
94 Fugue 81.3425% -31 - C3 -4IAO - SIR2_YEAST -
71 HHSearch 81.2128% -37 - C3 -1YC5 - NPD_THEMA -
84 HHSearch 79.6226% -22 - C3 -2HJH 3.2 SIR2_YEAST
85 HHSearch 78.7230% -14 - C3 -4FVT - SIR3_HUMAN -
35 PsiBlast_CBE 77.2431% -6 - C3 -4BVB 8.1 SIR3_HUMAN
34 PsiBlast_CBE 76.5031% -9 - C3 -4BVE - SIR3_HUMAN -
63 PsiBlast_CBE 76.4831% -13 - C3 -5D7N - SIR3_HUMAN -
74 HHSearch 76.1328% -28 - C3 -1S7G - NPD2_ARCFU -
32 PsiBlast_CBE 76.1031% -5 - C3 -4BVG 8.7 SIR3_HUMAN
65 PsiBlast_CBE 76.0531% -10 - C3 -5D7N - SIR3_HUMAN -
78 HHSearch 76.0328% -3 - C3 -5MAR 3.5 SIR2_HUMAN
31 PsiBlast_CBE 75.9931% -12 - C3 -4BVH 9.0 SIR3_HUMAN
37 PsiBlast_CBE 75.8231% -7 - C3 -4BN4 9.7 SIR3_HUMAN
68 PsiBlast_CBE 75.7631% -12 - C3 -5D7N - SIR3_HUMAN -
30 PsiBlast_CBE 75.5431% -6 - C3 -4BVH 3.1 SIR3_HUMAN
41 PsiBlast_CBE 74.5331% -9 - C3 -4JSR 7.7 SIR3_HUMAN
40 PsiBlast_CBE 72.7431% -8 - C3 -4JT8 6.9 SIR3_HUMAN
13 PsiBlast_PDB 72.2534% -12 - C3 -4BV2 4.4 NPD_THEMA
39 PsiBlast_CBE 72.1431% -11 - C3 -4JT9 3.7 SIR3_HUMAN
3 PsiBlast_PDB 70.2134% -9 - C3 -2H4J 3.5 NPD_THEMA
1 PsiBlast_PDB 67.7934% -12 - C3 -1YC5 2.9 NPD_THEMA