@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYL2: (2017-12-15 )
MSVIVLAGTIGAGKSSLTEMMAEHFDSQAFYESIDDNEVLPLFYANPEQYAFLLQIYFLNKRFASIKQAMKDDNNVLDRSIYEDSLLFHLNADLGRATETEVRVYDELLENMMEELPYAAHKKHPDLLVHIRVSFDTMLERIEKRGRSYEQLSFDPSLYDYYKELNRRYDQWYEEYKESPKIQIDGDRYNFVEDPQAKEEVLKMIEEKLAEIRQTKVAI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_A_7(2JAS)
?
[Raw transfer]




DTP_E_15(2JAS)
?
[Raw transfer]




DCM_B_8(2JAT)
?
[Raw transfer]




DCM_A_5(2JAT)
?
[Raw transfer]




POP_B_7(2JAT)
?
[Raw transfer]




37 HHSearch 75.5530% -20 - C1 -2JAS - ? -
21 PsiBlast_CBE 70.7631% -60 - C1 -2JAT 5.2 ?
1 PsiBlast_PDB 69.8431% -56 - C1 -2JAQ 5.1 ?
3 PsiBlast_PDB 68.7631% -37 - C1 -2JAS 6.8 ?
26 PsiBlast_CBE 68.5231% -47 - C1 -2JAS - ? -
23 PsiBlast_CBE 68.0231% -49 - C1 -2JAS 5.9 ?
2 PsiBlast_PDB 67.7331% -60 - C1 -2JAT 5.3 ?
22 PsiBlast_CBE 67.6831% -52 - C1 -2JAS - ? -
25 PsiBlast_CBE 67.3031% -51 - C1 -2JAS - ? -
35 HHSearch 66.4416% 18 * C1 *2OCP - DGUOK_HUMAN -
38 HHSearch 66.3624% 32 - C1 -3IPX - DCK_HUMAN -
17 PsiBlast_PDB 66.2025% 17 - C1 -4Q1E - DCK_HUMAN -
10 PsiBlast_PDB 64.8825% 27 - C1 -4JLJ - DCK_HUMAN -
15 PsiBlast_PDB 64.5325% 11 - C1 -4Q19 - DCK_HUMAN -
24 PsiBlast_CBE 63.8631% -45 - C1 -2JAS - ? -
8 PsiBlast_PDB 63.7025% 24 - C1 -4JLK - DCK_HUMAN -
12 PsiBlast_PDB 63.4125% 22 - C1 -4JLN - DCK_HUMAN -
6 PsiBlast_PDB 63.2825% 18 - C1 -3QEJ - DCK_HUMAN -
19 PsiBlast_PDB 62.9625% 36 - C1 -4Q1A - DCK_HUMAN -
9 PsiBlast_PDB 62.7825% 19 - C1 -4L5B - DCK_HUMAN -