@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TZA0: (2017-12-16 )
MPIIVIIVAGTIGAGKSTLTEMLAQDLETKPFYENVEDNEVLPLFYSNPEKYTFLLQIFFLNKRFLAIKDAFSHDDNVLDRSIYEDSMLFHLNADLGRVSEVEVKQYEGLLETMLKELEEISPQKKPDLLVYIRVSFETMLARIKKRGREYEQLEQDPELYSYYKELNRRYEEWYEQFDICPKIVIDGDKYDFVADPACGEQIVQEIKMRAKKMTEEADAQSIRYTTNNPKAKGIFTTK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_C_12(2JAS)
?
[Raw transfer]




DTP_E_15(2JAS)
?
[Raw transfer]




DCM_B_8(2JAT)
?
[Raw transfer]




DCM_A_5(2JAT)
?
[Raw transfer]




POP_B_7(2JAT)
?
[Raw transfer]




21 PsiBlast_CBE 82.1233% -62 - C1 -2JAT 5.3 ?
23 PsiBlast_CBE 82.0133% -44 - C1 -2JAS 5.9 ?
42 HHSearch 81.5931% -28 - C1 -2JAS - ? -
26 PsiBlast_CBE 81.5533% -44 - C1 -2JAS - ? -
22 PsiBlast_CBE 81.2133% -52 - C1 -2JAS - ? -
1 PsiBlast_PDB 80.4833% -56 - C1 -2JAQ 5.4 ?
25 PsiBlast_CBE 80.1433% -49 - C1 -2JAS 5.8 ?
3 PsiBlast_PDB 78.1133% -43 - C1 -2JAS - ? -
2 PsiBlast_PDB 77.6033% -63 - C1 -2JAT 5.5 ?
24 PsiBlast_CBE 74.1533% -44 - C1 -2JAS - ? -
43 HHSearch 73.4826% 26 - C1 -3IPX - DCK_HUMAN -
19 PsiBlast_PDB 72.5426% -3 - C1 -2VPP - DNK_DROME -
39 HHSearch 72.3021% 3 - C1 -2OCP - DGUOK_HUMAN -
9 PsiBlast_PDB 71.3526% 4 - C1 -2VP0 - DNK_DROME -
12 PsiBlast_PDB 71.3326% -15 - C1 -2JJ8 - DNK_DROME -
17 PsiBlast_PDB 70.6826% 3 - C1 -2VP9 - DNK_DROME -
8 PsiBlast_PDB 70.5426% 7 - C1 -1OT3 - DNK_DROME -
15 PsiBlast_PDB 70.2426% 6 - C1 -2VP5 - DNK_DROME -
10 PsiBlast_PDB 69.8726% 2 - C1 -1J90 - DNK_DROME -
7 PsiBlast_PDB 69.3926% 10 - C1 -1ZM7 - DNK_DROME -