@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TZW1: (2017-12-17 )
MEFLKEIIHNSWQEVLSSEFSKDYYLHLREFLKKEYASQKIHPDMYHIYEALELTPYEEVKVVILGQDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELYDDLGIAPVQHGNLVSWAKQGVLLLNTVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIIITSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLPETV

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FCF_A_2(3FCF)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




3FL_B_8(3FCL)
UNG_HUMAN
[Raw transfer]




3FL_A_3(3FCL)
UNG_HUMAN
[Raw transfer]




5NU_A_2(4WS5)
UNG_MYCTU
[Raw transfer]




302_B_2(2HXM)
UNG_HUMAN
[Raw transfer]




URA_A_2(4WRU)
UNG_MYCTU
[Raw transfer]




URA_A_2(4WPL)
UNG_MYCTU
[Raw transfer]




URA_B_2(5EUG)
UNG_ECOLI
[Raw transfer]




URF_A_2(4WS0)
UNG_MYCTU
[Raw transfer]




URF_A_2(4WS1)
UNG_MYCTU
[Raw transfer]




URA_B_2(2EUG)
UNG_ECOLI
[Raw transfer]




GOL_B_5(1OKB)
?
[Raw transfer]




URA_A_2(4WRV)
UNG_MYCTU
[Raw transfer]




GOL_A_3(1OKB)
?
[Raw transfer]




GOL_B_2(3EUG)
UNG_ECOLI
[Raw transfer]




GOL_A_8(4WRW)
UNG_MYCTU
[Raw transfer]




FCK_B_2(3FCK)
UNG_HUMAN
[Raw transfer]




DUR_A_2(2C53)
UNG_HHV11
[Raw transfer]




6UA_A_2(4WS3)
UNG_MYCTU
[Raw transfer]




URA_D_4(1UDH)
UNG_HHV11
[Raw transfer]




5UC_A_2(4WS7)
UNG_MYCTU
[Raw transfer]




URA_B_2(1FLZ)
UNG_ECOLI
[Raw transfer]




TUL_A_2(4WS8)
UNG_MYCTU
[Raw transfer]




NACID_B_2(4UQM)
UNG_DEIRA
[Raw transfer]

-

GOL_A_4(3ZOQ)
UNG_BACSU
[Raw transfer]




NACID_B_2(4UQM)
UNG_DEIRA
[Raw transfer]

-

GOL_A_4(3ZOQ)
UNG_BACSU
[Raw transfer]




CIT_A_3(4WS4)
UNG_MYCTU
[Raw transfer]




EDO_A_5(4WS0)
UNG_MYCTU
[Raw transfer]




EDO_A_4(4WS1)
UNG_MYCTU
[Raw transfer]




CIT_A_4(4WS6)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WRZ)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WPK)
UNG_MYCTU
[Raw transfer]




CIT_A_3(4WS2)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WPK)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WRY)
UNG_MYCTU
[Raw transfer]




NACID_D_1(1LAU)
UNG_HHV11
[Raw transfer]

-

DMS_A_5(4WPL)
UNG_MYCTU
[Raw transfer]




NACID_A_1(2SSP)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(1EMJ)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(1SSP)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1EMH)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1Q3F)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(2OXM)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(2OXM)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(1EMH)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(4SKN)
UNG_HUMAN
[Raw transfer]

-

74 HHSearch 97.4563%-102 - C8 -3ZOQ 2.2 UNG_BACSU
75 HHSearch 97.2063%-100 - C8 -3ZOR - UNG_BACSU -
1 PsiBlast_PDB 97.0862%-102 - C8 -3ZOQ 2.2 UNG_BACSU
2 PsiBlast_PDB 96.8362%-100 - C8 -3ZOR - UNG_BACSU -
4 PsiBlast_PDB 88.4357% -99 - C8 -3WDG - UNG_STAAR -
5 PsiBlast_PDB 85.0458% -25 - C8 -2BOO - UNG_DEIRA -
79 HHSearch 84.9257% -26 - C8 -2BOO - UNG_DEIRA -
6 PsiBlast_PDB 83.7358% -28 - C8 -3UFM - UNG_DEIRA -
80 HHSearch 82.0556% -22 - C8 -4UQM 9.0 UNG_DEIRA
7 PsiBlast_PDB 82.0157% -23 - C8 -4UQM 9.0 UNG_DEIRA
30 PsiBlast_CBE 81.3650% -30 - C8 -1OKB 3.2 ?
23 PsiBlast_CBE 81.2850% -30 - C8 -3FCK 3.9 UNG_HUMAN
29 PsiBlast_CBE 81.1650% -30 - C8 -1OKB 3.1 ?
17 PsiBlast_PDB 80.7850% -29 - C8 -1AKZ - UNG_HUMAN -
76 HHSearch 80.7450% -28 * C8 *3FCI 5.4 UNG_HUMAN
24 PsiBlast_CBE 80.7050% -25 - C8 -3FCI 5.4 UNG_HUMAN
22 PsiBlast_CBE 80.3850% -27 - C8 -3FCL 5.8 UNG_HUMAN
27 PsiBlast_CBE 80.2750% -23 - C8 -2SSP 6.8 UNG_HUMAN
12 PsiBlast_PDB 79.9750% -27 - C8 -1SSP 8.2 UNG_HUMAN
10 PsiBlast_PDB 79.9551% -26 - C8 -3TKB - UNG_HUMAN -
21 PsiBlast_CBE 79.7250% -25 - C8 -3FCL 6.1 UNG_HUMAN
16 PsiBlast_PDB 79.2350% -21 - C8 -2HXM 5.4 UNG_HUMAN
13 PsiBlast_PDB 79.0750% -23 - C8 -1EMH 11.0 UNG_HUMAN
20 PsiBlast_PDB 78.9150% -23 - C8 -3FCF 5.6 UNG_HUMAN
15 PsiBlast_PDB 78.5650% -24 - C8 -1Q3F 3.8 UNG_HUMAN
14 PsiBlast_PDB 78.3750% -24 - C8 -1EMJ 9.2 UNG_HUMAN
77 HHSearch 77.8150% -22 - C8 -2OXM 6.5 UNG_HUMAN
18 PsiBlast_PDB 77.2250% -18 - C8 -2OXM 6.5 UNG_HUMAN
31 PsiBlast_CBE 76.5349% -22 - C8 -4SKN 9.4 UNG_HUMAN
51 PsiBlast_CBE 74.5646% -11 - C8 -4WRU 3.5 UNG_MYCTU
42 PsiBlast_CBE 74.4446% -16 - C8 -4WS3 3.6 UNG_MYCTU
44 PsiBlast_CBE 74.2046% -14 - C8 -4WS1 3.3 UNG_MYCTU
37 PsiBlast_CBE 74.2046% -12 - C8 -4WS8 3.1 UNG_MYCTU
59 PsiBlast_CBE 73.7737% -31 - C8 -1UDH 3.6 UNG_HHV11
45 PsiBlast_CBE 73.7146% -11 - C8 -4WS0 3.3 UNG_MYCTU
50 PsiBlast_CBE 73.7046% -15 - C8 -4WRV 3.4 UNG_MYCTU
49 PsiBlast_CBE 73.6546% -10 - C8 -4WRW 2.5 UNG_MYCTU
47 PsiBlast_CBE 73.2246% -7 - C8 -4WRY 2.3 UNG_MYCTU
38 PsiBlast_CBE 73.2246% -8 - C8 -4WS7 3.3 UNG_MYCTU
40 PsiBlast_CBE 72.9246% -8 - C8 -4WS5 3.9 UNG_MYCTU
61 PsiBlast_CBE 72.7137% -27 - C8 -1LAU 5.9 UNG_HHV11
52 PsiBlast_CBE 72.6546% -3 - C8 -4WPL 3.3 UNG_MYCTU
46 PsiBlast_CBE 71.8746% -3 - C8 -4WRZ 2.5 UNG_MYCTU
53 PsiBlast_CBE 71.6746% -3 - C8 -4WPK 2.6 UNG_MYCTU
41 PsiBlast_CBE 71.6246% -3 - C8 -4WS4 2.3 UNG_MYCTU
43 PsiBlast_CBE 71.4746% -3 - C8 -4WS2 2.4 UNG_MYCTU
39 PsiBlast_CBE 71.4446% -2 - C8 -4WS6 2.1 UNG_MYCTU
85 HHSearch 71.3746% -1 - C8 -4WPK 2.6 UNG_MYCTU
33 PsiBlast_CBE 71.3651% 3 - C8 -2EUG 3.3 UNG_ECOLI
32 PsiBlast_CBE 71.2751% 4 - C8 -3EUG 2.6 UNG_ECOLI
35 PsiBlast_CBE 71.2051% 11 - C8 -5EUG 3.3 UNG_ECOLI
63 PsiBlast_CBE 70.7436% -26 - C8 -2C53 4.2 UNG_HHV11
34 PsiBlast_CBE 69.0451% 2 - C8 -1FLZ 3.6 UNG_ECOLI