@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U031: (2017-12-17 )
MMELQFPLHNDTSRKIIHIDMDAFFASVEERDHPEFRGHPLVIARHPSDTGGRGVVTTANYEARKFGIHSAMSAQKAYELCPQAIFKPGDHHKYSDISKQVREVFYRYTDIVEPVSIDEAYLDVTENKINCKSAIKIARMIQADIWESVQLTCSAGVSYNKFLAKLASDYQKPRGITVVAPQDAVPFLKALPIEKFHGVGKKTVPRMHELGIYTGKDLYECTEMMLIRNFGKMGYSLYRKVRGIHDSPVNVTRERKSVGKEHTYGQPLQTEEAVLTQLRQLAEKVEEALRRVQKHGKTVVLKVRYTDYSTVTKRVTLPEYIYKKEALFYQASLIWEEILGVEKGIRLLGITLTNLDPMTYENIVLPLWENQEI

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DGT_B_11(3RAX)
DPO4_SULSO
[Raw transfer]




XG4_A_10(4IR9)
DPO4_ECOLI
[Raw transfer]




0KX_A_7(4Q43)
DPO4_ECOLI
[Raw transfer]




1FZ_B_9(4R8U)
?
[Raw transfer]




8GT_A_7(5C5J)
?
[Raw transfer]




0KX_A_10(4IRC)
DPO4_ECOLI
[Raw transfer]




1FZ_A_7(4Q44)
DPO4_ECOLI
[Raw transfer]




1FZ_A_10(4IR1)
DPO4_ECOLI
[Raw transfer]




8GT_A_7(5C5J)
?
[Raw transfer]




1FZ_A_10(4Q45)
DPO4_ECOLI
[Raw transfer]




XG4_F_7(4IR9)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4IR1)
DPO4_ECOLI
[Raw transfer]




1FZ_F_10(4Q44)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4Q45)
DPO4_ECOLI
[Raw transfer]




DZ4_F_7(4IRD)
DPO4_ECOLI
[Raw transfer]




1FZ_A_8(4R8U)
DPO4_ECOLI
[Raw transfer]




DCP_A_9(4IRK)
DPO4_ECOLI
[Raw transfer]




0KX_F_10(4Q43)
DPO4_ECOLI
[Raw transfer]




DZ4_A_10(4IRD)
DPO4_ECOLI
[Raw transfer]




DZ4_A_10(4IRD)
DPO4_ECOLI
[Raw transfer]




0KX_F_7(4IRC)
DPO4_ECOLI
[Raw transfer]




DG3_P_5(3BQ1)
DPO4_SULAC
[Raw transfer]




DCP_B_7(4IRK)
DPO4_ECOLI
[Raw transfer]




DTP_A_8(5KFZ)
POLH_HUMAN
[Raw transfer]




TTP_A_9(2OH2)
POLK_HUMAN
[Raw transfer]




DTP_A_4(3MFI)
POLH_YEAST
[Raw transfer]




DCP_A_7(4F4Y)
DPO4_SULAC
[Raw transfer]




DCP_C_12(4F4Y)
DPO4_SULAC
[Raw transfer]




DGT_A_7(2W7O)
POLK_HUMAN
[Raw transfer]




TTP_T_9(4TQR)
DPO4_SULSO
[Raw transfer]




34 HHSearch 83.2841% -98 - C1 -4IRD 6.0 DPO4_ECOLI
37 HHSearch 79.4040% -93 - C1 -5C5J 3.5 ?
39 HHSearch 70.5628% -83 - C1 -4TQR 2.8 DPO4_SULSO
38 HHSearch 70.3328% -85 - C1 -3RAX 6.0 DPO4_SULSO
30 PsiBlast_CBE 68.5540% -25 - C1 -4R8U 4.4 ?
22 PsiBlast_CBE 68.4240% -20 - C1 -4Q43 4.8 DPO4_ECOLI
1 PsiBlast_PDB 68.3240% -20 - C1 -4IR1 4.8 DPO4_ECOLI
21 PsiBlast_CBE 67.8540% -18 - C1 -5C5J 3.5 ?
3 PsiBlast_PDB 67.7840% -18 - C1 -4Q43 4.8 DPO4_ECOLI
4 PsiBlast_PDB 67.6140% -17 - C1 -5C5J - ? -
2 PsiBlast_PDB 67.5340% -17 - C1 -4IR9 5.1 DPO4_ECOLI
24 PsiBlast_CBE 67.0240% -20 - C1 -4IR1 5.2 DPO4_ECOLI
27 PsiBlast_CBE 66.3041% 16 - C1 -4IRK 4.1 DPO4_ECOLI
23 PsiBlast_CBE 66.2540% -18 - C1 -4IR9 6.1 DPO4_ECOLI
8 PsiBlast_PDB 65.9841% 9 - C1 -4Q44 4.4 DPO4_ECOLI
28 PsiBlast_CBE 65.4341% 17 - C1 -4IRD 6.0 DPO4_ECOLI
5 PsiBlast_PDB 64.8941% 18 - C1 -4IRC 5.4 DPO4_ECOLI
26 PsiBlast_CBE 64.6441% 14 - C1 -4Q44 3.3 DPO4_ECOLI
9 PsiBlast_PDB 64.2641% 16 - C1 -4Q45 4.5 DPO4_ECOLI
6 PsiBlast_PDB 64.1641% 16 - C1 -4IRD 5.2 DPO4_ECOLI
25 PsiBlast_CBE 63.9741% 14 - C1 -4Q45 4.6 DPO4_ECOLI
7 PsiBlast_PDB 63.9141% 16 - C1 -4IRK 3.3 DPO4_ECOLI
10 PsiBlast_PDB 61.9040% 14 - C1 -4R8U 4.5 DPO4_ECOLI
59 Fugue 60.1330% 24 - C1 -2OH2 4.8 POLK_HUMAN
29 PsiBlast_CBE 59.9141% 20 - C1 -4IRC 4.4 DPO4_ECOLI
60 Fugue 57.1630% 29 - C1 -2W7O 4.5 POLK_HUMAN
13 PsiBlast_PDB 55.6836% -24 - C1 -4F4Y 3.8 DPO4_SULAC (first)
32 PsiBlast_CBE 53.8836% -23 - C1 -4F4Y 4.0 DPO4_SULAC (first)
18 PsiBlast_PDB 52.4640% -67 - C1 -3BQ1 3.8 DPO4_SULAC