@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U0N5: (2017-12-18 )
MWLSNEGGFYMKKISTLLFIGLVSLGLFGFSIPGFAHGYITSPGSRAYLGTSAAGNLNQNVGRAQWEPQSIEATKNTFIDGKIASAGVSGFEPLDEQTSNRWHKNMVNPGTLNITWNLTAQHRTSTWDYYITKPTWNPNQPLKFSDFELITKIDDKATVPPKTVNQTITLPQDRKGYNVILAVWNISDTTNAFYQVIDVNIQ

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_4(2BEM)
?
[Raw transfer]




EDO_A_4(2BEM)
?
[Raw transfer]




EDO_A_4(2BEM)
?
[Raw transfer]




EDO_B_12(2BEM)
?
[Raw transfer]




EDO_B_16(2BEM)
?
[Raw transfer]




EDO_A_5(2YOY)
?
[Raw transfer]




EDO_B_8(2YOY)
?
[Raw transfer]




EDO_B_8(2YOY)
?
[Raw transfer]




6 PsiBlast_PDB 99.2972% -72 - C4 -4ALS - ? -
4 PsiBlast_PDB 99.1372% -72 - C4 -4ALQ - ? -
48 HHSearch 99.0372% -74 - C4 -4ALC - ? -
2 PsiBlast_PDB 99.0372% -74 - C4 -4ALC - ? -
5 PsiBlast_PDB 98.6072% -74 - C4 -4ALR - ? -
7 PsiBlast_PDB 98.5972% -73 - C4 -4ALT - ? -
3 PsiBlast_PDB 97.9772% -71 - C4 -4ALE - ? -
39 Fugue 75.9745% - - C4 -2XWX - GBPA_VIBCH -
16 PsiBlast_PDB 74.4942% 0 - C- -2XWX - GBPA_VIBCH -
38 Fugue 70.9047% 40 - C4 -2BEM 2.6 ?
52 HHSearch 70.3448% 41 * C4 *2BEM 2.6 ?
8 PsiBlast_PDB 69.2646% 40 - C4 -2BEM 2.6 ?
9 PsiBlast_PDB 69.0846% 31 - C4 -2LHS - ? -
22 PsiBlast_CBE 68.4246% 37 - C4 -2BEM 2.6 ?
50 HHSearch 68.3041% 37 - C4 -5FTZ - ? -
21 PsiBlast_CBE 67.3146% 43 - C4 -2BEM - ? -
53 HHSearch 66.9552% 42 - C4 -5WSZ - ? -
10 PsiBlast_PDB 66.8746% 47 - C4 -2BEN - ? -
20 PsiBlast_PDB 66.5436% -48 - C4 -5VG1 - ? -
17 PsiBlast_PDB 66.2437% 37 - C4 -5FTZ - ? -
55 HHSearch 64.1145% 61 - C4 -2YOY 3.6 ?
15 PsiBlast_PDB 63.4743% 64 - C4 -2YOY 3.6 ?
27 PsiBlast_CBE 63.1843% 66 - C4 -2YOY 3.6 ?