@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U217: (2017-12-21 )
MTTQELDELAHSEAGAFITKSCTINERKGNPEPRYFDVPLGSINSMGLPNLGFSYYLEYALAYEKVQENQNQPLFFSIAGMSVQENLEMLEKIEKSGFNGITELNLSCPNVPGKPQLAYDFEATYETLKEVFSIFSKPLGIKLPPYFDFAHFDQMADILNQFPLTYVNAINSVGNGLYIDTEQEAVVIKPKEGFGGIGGEYIKPTALANVRAFYTRLKPEIQIIGTGGIRTGQDAFEHLLCGASMLQIGTELHKEGPEIFSRIIKELTQIMSEKGYTSIDEFKGKLRTIS

Atome Classification :

(108 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

W7P_B_20(3W7P)
PYRD_TRYCC
[Raw transfer]




W87_B_(3W87)
PYRD_TRYCC
[Raw transfer]




DOR_B_7(2E68)
PYRD_TRYCC
[Raw transfer]




W86_B_(3W86)
PYRD_TRYCC
[Raw transfer]




DOR_A_5(2E68)
PYRD_TRYCC
[Raw transfer]




W7O_B_15(3W7O)
PYRD_TRYCC
[Raw transfer]




W88_B_(3W88)
PYRD_TRYCC
[Raw transfer]




W7Q_B_17(3W7Q)
PYRD_TRYCC
[Raw transfer]




34D_B_8(2BX7)
PYRDA_LACLM
[Raw transfer]




W7F_B_17(3W7E)
PYRD_TRYCC
[Raw transfer]




W7A_B_20(3W71)
PYRD_TRYCC
[Raw transfer]




DHB_B_8(2BSL)
PYRDA_LACLM
[Raw transfer]




5LL_B_25(5E93)
PYRD_TRYCC
[Raw transfer]




GOL_B_18(3W7Q)
PYRD_TRYCC
[Raw transfer]




GOL_B_21(3W71)
PYRD_TRYCC
[Raw transfer]




5LL_A_3(5E93)
PYRD_TRYCC
[Raw transfer]




FMN_A_15(3W7N)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(4EF8)
?
[Raw transfer]




FMN_A_17(3W7M)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(1JRB)
PYRDA_LACLM
[Raw transfer]




FMN_A_12(3W85)
PYRD_TRYCC
[Raw transfer]




FMN_A_9(3W84)
PYRD_TRYCC
[Raw transfer]




FMN_B_(3W7I)
PYRD_TRYCC
[Raw transfer]




FMN_B_5(1JRB)
PYRDA_LACLM
[Raw transfer]




FMN_A_9(3C3N)
PYRD_TRYCC
[Raw transfer]




FMN_B_5(2DOR)
PYRDA_LACLM
[Raw transfer]




FMN_A_13(3W7J)
PYRD_TRYCC
[Raw transfer]




FMN_D_12(3C3N)
PYRD_TRYCC
[Raw transfer]




FMN_B_24(3W7M)
PYRD_TRYCC
[Raw transfer]




FMN_A_10(5E93)
PYRD_TRYCC
[Raw transfer]




FMN_B_18(3W84)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(2DOR)
PYRDA_LACLM
[Raw transfer]




FMN_A_3(2DOR)
PYRDA_LACLM
[Raw transfer]




FMN_B_19(3W70)
PYRD_TRYCC
[Raw transfer]




FMN_A_14(3W7C)
PYRD_TRYCC
[Raw transfer]




FMN_B_18(3W7N)
PYRD_TRYCC
[Raw transfer]




FMN_B_25(3W83)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(2DOR)
PYRDA_LACLM
[Raw transfer]




FMN_B_24(3W7C)
PYRD_TRYCC
[Raw transfer]




FMN_A_5(1JQX)
PYRDA_LACLM
[Raw transfer]




FMN_A_13(3W7I)
PYRD_TRYCC
[Raw transfer]




FMN_A_12(4JD4)
PYRD_TRYCC
[Raw transfer]




FMN_A_12(3W7G)
PYRD_TRYCC
[Raw transfer]




FMN_A_14(3W86)
PYRD_TRYCC
[Raw transfer]




FMN_B_21(3W76)
PYRD_TRYCC
[Raw transfer]




FMN_A_12(3W73)
PYRD_TRYCC
[Raw transfer]




FMN_B_7(1JQX)
PYRDA_LACLM
[Raw transfer]




FMN_A_15(3W7Q)
PYRD_TRYCC
[Raw transfer]




FMN_B_26(3W7J)
PYRD_TRYCC
[Raw transfer]




FMN_A_13(3W7K)
PYRD_TRYCC
[Raw transfer]




FMN_A_5(1JQV)
PYRDA_LACLM
[Raw transfer]




FMN_A_19(3W88)
PYRD_TRYCC
[Raw transfer]




FMN_C_11(3C3N)
PYRD_TRYCC
[Raw transfer]




FMN_B_10(3C3N)
PYRD_TRYCC
[Raw transfer]




FMN_B_16(3W85)
PYRD_TRYCC
[Raw transfer]




FMN_C_24(3C61)
?
[Raw transfer]




FMN_D_26(3C61)
?
[Raw transfer]




FMN_A_13(3W70)
PYRD_TRYCC
[Raw transfer]




FMN_B_7(1JQV)
PYRDA_LACLM
[Raw transfer]




FMN_B_21(3W75)
PYRD_TRYCC
[Raw transfer]




FMN_B_4(1DOR)
PYRDA_LACLM
[Raw transfer]




FMN_B_22(3C61)
?
[Raw transfer]




FMN_B_7(2BSL)
PYRDA_LACLM
[Raw transfer]




FMN_B_11(3TQ0)
?
[Raw transfer]




FMN_A_3(2BSL)
PYRDA_LACLM
[Raw transfer]




FMN_A_12(3W75)
PYRD_TRYCC
[Raw transfer]




FMN_B_22(3W7K)
PYRD_TRYCC
[Raw transfer]




FMN_B_7(2BSL)
PYRDA_LACLM
[Raw transfer]




FMN_A_19(3W87)
PYRD_TRYCC
[Raw transfer]




FMN_A_13(3W76)
PYRD_TRYCC
[Raw transfer]




FMN_A_18(3W7P)
PYRD_TRYCC
[Raw transfer]




FMN_B_7(2BX7)
PYRDA_LACLM
[Raw transfer]




FMN_A_19(3W88)
PYRD_TRYCC
[Raw transfer]




FMN_B_(3W74)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(1DOR)
PYRDA_LACLM
[Raw transfer]




FMN_B_24(4JD4)
PYRD_TRYCC
[Raw transfer]




FMN_A_19(3C61)
?
[Raw transfer]




FMN_A_13(3W7D)
PYRD_TRYCC
[Raw transfer]




FMN_A_14(4JDB)
PYRD_TRYCC
[Raw transfer]




FMN_A_4(2E6D)
PYRD_TRYCC
[Raw transfer]




FMN_B_6(2E6F)
PYRD_TRYCC
[Raw transfer]




FMN_B_6(2E6A)
PYRD_TRYCC
[Raw transfer]




FMN_A_13(3W74)
PYRD_TRYCC
[Raw transfer]




FMN_A_4(2E6A)
PYRD_TRYCC
[Raw transfer]




FMN_A_13(3W83)
PYRD_TRYCC
[Raw transfer]




FMN_B_22(3W73)
PYRD_TRYCC
[Raw transfer]




FMN_A_4(2E6F)
PYRD_TRYCC
[Raw transfer]




FMN_A_4(2E6F)
PYRD_TRYCC
[Raw transfer]




FMN_A_11(5EA9)
PYRD_TRYCC
[Raw transfer]




FMN_A_13(3W7O)
PYRD_TRYCC
[Raw transfer]




FMN_B_23(3W7D)
PYRD_TRYCC
[Raw transfer]




FMN_A_15(3W7E)
PYRD_TRYCC
[Raw transfer]




FMN_B_26(3W7L)
PYRD_TRYCC
[Raw transfer]




FMN_B_9(2E6D)
PYRD_TRYCC
[Raw transfer]




FMN_B_6(2E68)
PYRD_TRYCC
[Raw transfer]




FMN_A_18(3W71)
PYRD_TRYCC
[Raw transfer]




FMN_B_21(4JDB)
PYRD_TRYCC
[Raw transfer]




FMN_A_4(2E68)
PYRD_TRYCC
[Raw transfer]




FMN_A_5(1JUE)
PYRDA_LACLM
[Raw transfer]




FMN_B_5(1JRC)
PYRDA_LACLM
[Raw transfer]




FMN_B_(3W7H)
PYRD_TRYCC
[Raw transfer]




FMN_B_6(1JUE)
PYRDA_LACLM
[Raw transfer]




FMN_A_3(2BX7)
PYRDA_LACLM
[Raw transfer]




FMN_A_13(3W7H)
PYRD_TRYCC
[Raw transfer]




FMN_B_6(1JUB)
PYRDA_LACLM
[Raw transfer]




FMN_B_24(5EA9)
PYRD_TRYCC
[Raw transfer]




FMN_A_5(1JUB)
PYRDA_LACLM
[Raw transfer]




FMN_B_6(1JUB)
PYRDA_LACLM
[Raw transfer]




FMN_A_5(1OVD)
PYRDA_LACLM
[Raw transfer]




FMN_B_6(1OVD)
PYRDA_LACLM
[Raw transfer]




FMN_A_13(3W7L)
PYRD_TRYCC
[Raw transfer]




FMN_B_21(3W7G)
PYRD_TRYCC
[Raw transfer]




FMN_A_16(3W72)
PYRD_TRYCC
[Raw transfer]




FMN_B_25(3W72)
PYRD_TRYCC
[Raw transfer]




FMN_A_3(1JRC)
PYRDA_LACLM
[Raw transfer]




ACY_B_8(1JUE)
PYRDA_LACLM
[Raw transfer]




ACY_A_7(1JUE)
PYRDA_LACLM
[Raw transfer]




25 PsiBlast_CBE 96.4274% -90 - C2 -1DOR 7.9 PYRDA_LACLM
21 PsiBlast_CBE 96.3574% -92 - C2 -2DOR 7.9 PYRDA_LACLM
23 PsiBlast_CBE 96.1174% -92 - C2 -2BSL 8.1 PYRDA_LACLM
2 PsiBlast_PDB 96.0874% -92 - C2 -2DOR 8.1 PYRDA_LACLM
1 PsiBlast_PDB 95.9774% -91 - C2 -1DOR 8.0 PYRDA_LACLM
22 PsiBlast_CBE 95.6774% -94 - C2 -2BX7 7.9 PYRDA_LACLM
24 PsiBlast_CBE 95.4974% -90 - C2 -1JUE 7.9 PYRDA_LACLM
8 PsiBlast_PDB 95.3273% -93 - C2 -1OVD 8.0 PYRDA_LACLM
3 PsiBlast_PDB 95.2674% -90 - C2 -1JUE 8.0 PYRDA_LACLM
5 PsiBlast_PDB 95.1074% -91 - C2 -2BX7 8.1 PYRDA_LACLM
10 PsiBlast_PDB 95.0373% -91 - C2 -1JRC 8.0 PYRDA_LACLM
31 PsiBlast_CBE 94.9873% -93 - C2 -1JQX 8.0 PYRDA_LACLM
26 PsiBlast_CBE 94.9773% -93 - C2 -1OVD 8.2 PYRDA_LACLM
4 PsiBlast_PDB 94.9374% -89 - C2 -2BSL 7.8 PYRDA_LACLM
29 PsiBlast_CBE 94.9073% -92 - C2 -1JRB 7.9 PYRDA_LACLM
27 PsiBlast_CBE 94.8973% -92 - C2 -1JUB 8.0 PYRDA_LACLM
7 PsiBlast_PDB 94.7673% -93 - C2 -1JUB 8.0 PYRDA_LACLM
11 PsiBlast_PDB 94.6573% -92 - C2 -1JQX 7.9 PYRDA_LACLM
30 PsiBlast_CBE 94.5873% -90 - C2 -1JRC 8.2 PYRDA_LACLM
28 PsiBlast_CBE 94.5873% -94 - C2 -1JQV 8.1 PYRDA_LACLM
6 PsiBlast_PDB 94.5273% -94 - C2 -1JQV 7.8 PYRDA_LACLM
9 PsiBlast_PDB 94.2873% -91 - C2 -1JRB 7.6 PYRDA_LACLM
78 PsiBlast_CBE 81.4354% -34 - C2 -3W7H 8.2 PYRD_TRYCC
42 PsiBlast_CBE 81.3154% -33 - C2 -3W87 7.2 PYRD_TRYCC
72 PsiBlast_CBE 81.2654% -34 - C2 -3W7K 8.2 PYRD_TRYCC
74 PsiBlast_CBE 81.0354% -35 - C2 -3W7J 8.0 PYRD_TRYCC
41 PsiBlast_CBE 81.0054% -34 - C2 -3W88 6.7 PYRD_TRYCC
119 HHSearch 80.8673% -8 - C2 -2BSL 8.1 PYRDA_LACLM
64 PsiBlast_CBE 80.7954% -35 - C2 -3W7O 8.3 PYRD_TRYCC
82 PsiBlast_CBE 80.7554% -34 - C2 -3W7E 8.1 PYRD_TRYCC
89 PsiBlast_CBE 80.7454% -34 - C2 -3W75 8.2 PYRD_TRYCC
54 PsiBlast_CBE 80.6954% -36 - C2 -3W85 8.4 PYRD_TRYCC
61 PsiBlast_CBE 80.6754% -35 - C2 -3W7P 5.4 PYRD_TRYCC
67 PsiBlast_CBE 80.6054% -33 - C2 -3W7M 8.0 PYRD_TRYCC
93 PsiBlast_CBE 80.3654% -34 - C2 -3W73 8.2 PYRD_TRYCC
56 PsiBlast_CBE 80.3054% -33 - C2 -3W84 7.6 PYRD_TRYCC
118 HHSearch 80.2873% -12 - C2 -1JUB 8.0 PYRDA_LACLM
95 PsiBlast_CBE 80.2554% -35 - C2 -3W72 8.0 PYRD_TRYCC
90 PsiBlast_CBE 80.2554% -33 - C2 -3W75 8.2 PYRD_TRYCC
86 PsiBlast_CBE 80.2154% -33 - C2 -3W7C 8.3 PYRD_TRYCC
68 PsiBlast_CBE 80.2154% -32 - C2 -3W7M 8.1 PYRD_TRYCC
80 PsiBlast_CBE 80.2054% -33 - C2 -3W7G 7.7 PYRD_TRYCC
76 PsiBlast_CBE 80.2054% -32 - C2 -3W7I 8.2 PYRD_TRYCC
57 PsiBlast_CBE 80.1654% -30 - C2 -3W83 7.8 PYRD_TRYCC
55 PsiBlast_CBE 80.1554% -33 - C2 -3W84 8.0 PYRD_TRYCC
51 PsiBlast_CBE 80.1454% -32 - C2 -3W86 6.1 PYRD_TRYCC
92 PsiBlast_CBE 80.1254% -33 - C2 -3W74 8.4 PYRD_TRYCC
60 PsiBlast_CBE 79.9954% -34 - C2 -3W7Q 8.5 PYRD_TRYCC
39 PsiBlast_CBE 79.9654% -30 - C2 -5EA9 8.2 PYRD_TRYCC
66 PsiBlast_CBE 79.9054% -32 - C2 -3W7N 7.9 PYRD_TRYCC
97 PsiBlast_CBE 79.8854% -31 - C2 -3W71 5.9 PYRD_TRYCC
33 PsiBlast_CBE 79.8855% -29 - C2 -3C3N 6.6 PYRD_TRYCC
19 PsiBlast_PDB 79.8554% -32 - C2 -3W87 8.2 PYRD_TRYCC
70 PsiBlast_CBE 79.8454% -30 - C2 -3W7L 8.4 PYRD_TRYCC
59 PsiBlast_CBE 79.8354% -33 - C2 -3W7Q 7.0 PYRD_TRYCC
18 PsiBlast_PDB 79.8154% -32 - C2 -3W88 8.2 PYRD_TRYCC
81 PsiBlast_CBE 79.7554% -31 - C2 -3W7E 6.7 PYRD_TRYCC
34 PsiBlast_CBE 79.7555% -29 - C2 -3C3N 7.7 PYRD_TRYCC
75 PsiBlast_CBE 79.7254% -29 - C2 -3W7I 8.2 PYRD_TRYCC
50 PsiBlast_CBE 79.6954% -32 - C2 -4JD4 8.2 PYRD_TRYCC
71 PsiBlast_CBE 79.6854% -31 - C2 -3W7K 8.3 PYRD_TRYCC
88 PsiBlast_CBE 79.6554% -33 - C2 -3W76 8.3 PYRD_TRYCC
87 PsiBlast_CBE 79.6454% -34 - C2 -3W76 8.5 PYRD_TRYCC
84 PsiBlast_CBE 79.5754% -34 - C2 -3W7D 8.2 PYRD_TRYCC
40 PsiBlast_CBE 79.5354% -26 - C2 -5E93 3.8 PYRD_TRYCC
77 PsiBlast_CBE 79.5154% -32 - C2 -3W7H 8.2 PYRD_TRYCC
69 PsiBlast_CBE 79.4854% -32 - C2 -3W7L 8.2 PYRD_TRYCC
49 PsiBlast_CBE 79.4354% -33 - C2 -4JD4 8.0 PYRD_TRYCC
99 PsiBlast_CBE 79.4254% -30 - C2 -3W70 7.6 PYRD_TRYCC
98 PsiBlast_CBE 79.3554% -33 - C2 -3W71 8.2 PYRD_TRYCC
91 PsiBlast_CBE 79.3454% -32 - C2 -3W74 8.0 PYRD_TRYCC
79 PsiBlast_CBE 79.3454% -30 - C2 -3W7G 8.4 PYRD_TRYCC
96 PsiBlast_CBE 79.3154% -32 - C2 -3W72 8.6 PYRD_TRYCC
48 PsiBlast_CBE 79.2854% -29 - C2 -4JDB 8.4 PYRD_TRYCC
62 PsiBlast_CBE 79.2454% -32 - C2 -3W7P 8.3 PYRD_TRYCC
35 PsiBlast_CBE 79.2454% -24 - C2 -3C61 7.5 ?
32 PsiBlast_CBE 79.2155% -28 - C2 -3C3N 7.3 PYRD_TRYCC
20 PsiBlast_PDB 79.1854% -28 - C2 -5E93 8.3 PYRD_TRYCC
44 PsiBlast_CBE 79.0954% -28 - C2 -2E6D 8.5 PYRD_TRYCC
52 PsiBlast_CBE 79.0654% -30 - C2 -3W86 8.2 PYRD_TRYCC
16 PsiBlast_PDB 79.0654% -27 - C2 -2E6D 8.4 PYRD_TRYCC
46 PsiBlast_CBE 79.0354% -26 - C2 -2E68 8.3 PYRD_TRYCC
58 PsiBlast_CBE 79.0054% -27 - C2 -3W83 7.1 PYRD_TRYCC
47 PsiBlast_CBE 78.9854% -32 - C2 -4JDB 8.2 PYRD_TRYCC
12 PsiBlast_PDB 78.8955% -29 - C2 -3C3N 7.5 PYRD_TRYCC
94 PsiBlast_CBE 78.8454% -31 - C2 -3W73 8.2 PYRD_TRYCC
83 PsiBlast_CBE 78.8054% -32 - C2 -3W7D 8.3 PYRD_TRYCC
14 PsiBlast_PDB 78.8054% -26 - C2 -2E68 8.4 PYRD_TRYCC
85 PsiBlast_CBE 78.7254% -31 - C2 -3W7C 8.3 PYRD_TRYCC
63 PsiBlast_CBE 78.7254% -31 - C2 -3W7O 5.5 PYRD_TRYCC
45 PsiBlast_CBE 78.6854% -28 - C2 -2E6A 8.4 PYRD_TRYCC