@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U2R8: (2017-12-23 )
MLRFFPQKNKYIQEKSEFQFNTDGPIPQHIAIIMDGNGRWAQNRRLPRVAGHKEGMETVKKVTKKASRLGVKVLTLYAFSTENWKRPKDEVSFLMQLPVDFFDTFVPELIKENVKVHVMGYENVLPEHTQDAVRRAIEQTKNNTGMVLNFALNYGSRAEIVTAVQEIAEEVAKGEIHAEEIDDELIAKHLMTGFLPKELQDPELMIRTSGEERISNFLLWQIAYSELYFTKALWPDFDGAHLEEAIASYQNRDRRFGGVKKTEDEKGDQS

Atome Classification :

(57 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_B_4(5KH4)
ISPT_STRPN
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




B08_B_6(2E99)
UPPS_ECOLI
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(5KH4)
ISPT_STRPN
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




B75_A_3(2E9C)
UPPS_ECOLI
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




DST_B_7(5HXT)
ZFPS_SOLHA
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




DST_A_4(5HXT)
ZFPS_SOLHA
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




PIS_A_3(5HC8)
?
[Raw transfer]




PIS_A_3(5HC8)
?
[Raw transfer]




DST_A_4(5HC7)
?
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B29_A_4(2E98)
UPPS_ECOLI
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




IPR_C_8(5HXP)
ZFPS_SOLHA
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




B28_A_4(2E9A)
UPPS_ECOLI
[Raw transfer]




DST_A_3(5HXQ)
ZFPS_SOLHA
[Raw transfer]




6TC_B_3(5KH5)
ISPT_STRPN
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




IPR_A_3(5HXP)
ZFPS_SOLHA
[Raw transfer]




IPR_A_3(5HXP)
ZFPS_SOLHA
[Raw transfer]




2BJ_A_7(3SGV)
UPPS_ECOLI
[Raw transfer]




B29_B_8(2E98)
UPPS_ECOLI
[Raw transfer]




2ZW_A_3(4Q9O)
ISPT_STRR6
[Raw transfer]




2ZW_A_3(4Q9O)
ISPT_STRR6
[Raw transfer]




2ZW_B_5(4Q9O)
ISPT_STRR6
[Raw transfer]




5 PsiBlast_PDB 93.3860%-102 - C6 -5KH4 5.7 ISPT_STRPN
25 PsiBlast_CBE 92.7960%-106 - C6 -5KH4 6.5 ISPT_STRPN
6 PsiBlast_PDB 92.4160%-105 - C6 -5KH5 - ISPT_STRPN -
4 PsiBlast_PDB 91.8360%-111 - C6 -5KH2 - ISPT_STRPN -
105 HHSearch 91.3358% -90 - C6 -4Q9O 8.6 ISPT_STRR6
7 PsiBlast_PDB 91.1855%-100 - C6 -4H8E 10.0 ISPT_STAAN
3 PsiBlast_PDB 90.4160% -94 - C6 -4Q9O 8.6 ISPT_STRR6
2 PsiBlast_PDB 90.3660% -97 - C6 -4Q9M 8.4 ISPT_STRR6
103 HHSearch 90.2354% -99 - C6 -4H8E 10.0 ISPT_STAAN
22 PsiBlast_CBE 90.1960% -96 - C6 -4Q9O 8.6 ISPT_STRR6
23 PsiBlast_CBE 90.0960%-100 - C6 -4Q9M 8.3 ISPT_STRR6
8 PsiBlast_PDB 89.8655% -99 - C6 -4U82 9.8 ISPT_STAAN
104 HHSearch 89.6158% -99 - C6 -4Q9M 8.3 ISPT_STRR6
24 PsiBlast_CBE 89.4260%-108 - C6 -5KH5 5.3 ISPT_STRPN
102 HHSearch 89.0754% -97 - C6 -4U82 9.8 ISPT_STAAN
51 PsiBlast_CBE 88.9546%-121 - C6 -1UEH - UPPS_ECOLI -
14 PsiBlast_PDB 88.5246%-116 - C6 -1X07 6.0 UPPS_ECOLI
53 PsiBlast_CBE 88.1645%-109 - C6 -1X08 8.1 UPPS_ECOLI
13 PsiBlast_PDB 87.3446%-109 - C6 -1X06 9.4 UPPS_ECOLI
12 PsiBlast_PDB 87.2646%-111 - C6 -1V7U 6.9 UPPS_ECOLI
60 PsiBlast_CBE 87.0244%-115 - C6 -4ONC 4.5 DPDS_MYCTU
52 PsiBlast_CBE 86.8645%-110 - C6 -1X09 5.0 UPPS_ECOLI
62 PsiBlast_CBE 86.4144%-118 - C6 -2VG3 7.3 DPDS_MYCTU
66 PsiBlast_CBE 86.3444%-117 - C6 -2VG2 2.6 DPDS_MYCTU
109 HHSearch 86.1345%-110 * C6 *1X09 5.0 UPPS_ECOLI
69 PsiBlast_CBE 86.1044%-109 - C6 -2VG2 3.1 DPDS_MYCTU
68 PsiBlast_CBE 86.0444%-113 - C6 -2VG2 4.2 DPDS_MYCTU
64 PsiBlast_CBE 85.3544%-111 - C6 -2VG3 7.9 DPDS_MYCTU
16 PsiBlast_PDB 85.3346%-109 - C6 -2E99 5.6 UPPS_ECOLI
67 PsiBlast_CBE 85.2344%-112 - C6 -2VG2 3.8 DPDS_MYCTU
43 PsiBlast_CBE 85.2146%-119 - C6 -3SGV 5.2 UPPS_ECOLI
63 PsiBlast_CBE 85.0944%-114 - C6 -2VG3 7.1 DPDS_MYCTU
59 PsiBlast_CBE 85.0343%-118 - C6 -5HXP 2.6 ZFPS_SOLHA
15 PsiBlast_PDB 84.9746%-108 - C6 -2E98 6.6 UPPS_ECOLI
100 HHSearch 84.8543%-122 - C6 -5HXP 2.6 ZFPS_SOLHA
65 PsiBlast_CBE 84.5544%-111 - C6 -2VG3 7.8 DPDS_MYCTU
54 PsiBlast_CBE 84.5543%-112 - C6 -5HXT 4.4 ZFPS_SOLHA
61 PsiBlast_CBE 84.1544%-116 - C6 -4ONC 7.3 DPDS_MYCTU
57 PsiBlast_CBE 84.0143%-112 - C6 -5HXQ 3.8 ZFPS_SOLHA
55 PsiBlast_CBE 83.8743%-112 - C6 -5HXT 3.6 ZFPS_SOLHA
48 PsiBlast_CBE 83.7246%-122 - C6 -2E99 5.3 UPPS_ECOLI
42 PsiBlast_CBE 83.6346%-124 - C6 -3SGV 7.0 UPPS_ECOLI
47 PsiBlast_CBE 83.6146%-122 - C6 -2E9A 3.9 UPPS_ECOLI
37 PsiBlast_CBE 83.4046%-123 - C6 -3WYJ 10.7 UPPS_ECOLI
98 HHSearch 82.8943%-107 - C6 -2VG3 7.1 DPDS_MYCTU
101 HHSearch 82.7045%-119 - C6 -3SGV 7.0 UPPS_ECOLI
38 PsiBlast_CBE 82.1946%-121 - C6 -3TH8 5.6 UPPS_ECOLI
49 PsiBlast_CBE 81.8746%-121 - C6 -2E98 4.3 UPPS_ECOLI
58 PsiBlast_CBE 81.6943%-115 - C6 -5HXP 2.7 ZFPS_SOLHA
17 PsiBlast_PDB 81.0446%-115 - C6 -2E9A 5.8 UPPS_ECOLI
19 PsiBlast_PDB 80.9946%-117 - C6 -2E9D 5.1 UPPS_ECOLI
46 PsiBlast_CBE 80.8046%-118 - C6 -2E9C 7.4 UPPS_ECOLI
18 PsiBlast_PDB 80.4246%-114 - C6 -2E9C 6.8 UPPS_ECOLI
108 HHSearch 79.1240% -32 - C6 -5HC8 3.7 ?
71 PsiBlast_CBE 78.9540% -41 - C6 -5HC7 2.5 ?
70 PsiBlast_CBE 78.8140% -37 - C6 -5HC8 3.7 ?
73 PsiBlast_CBE 71.2139%-106 - C6 -2DTN 4.7 ISPT_HELPY