@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U368: (2017-12-24 )
MKIDVLTLFPRMFEGPMGESIIGKAVDKGLLDINISNFRDYSDNKHQTVDDYPYGGGAGMLLKVQPIYDNIQAIEKAAPDVKKRVILLDPAGKRFDQKMAEEFSQEEHLVFICGHYEGYDERIRTLVTDEVSLGDYVLTGGELGAMVMIDATVRLLPDVLGNQTSAQTDSYSTGLLEHPQYTRPAEYKGMKVPEVLTNGNHKLIEEWQLKESLRRTYQRRPDLLETLEWTPQMTKFLEEIKKEEQEKTADEAK

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




4GX_A_2(4YQI)
TRMD_HAEIN
[Raw transfer]




4H7_A_2(4YQQ)
TRMD_HAEIN
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




4G0_A_2(4YQ5)
TRMD_HAEIN
[Raw transfer]




4G3_A_2(4YQ4)
TRMD_HAEIN
[Raw transfer]




4G4_A_2(4YQ7)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




4FD_A_2(4YPW)
TRMD_HAEIN
[Raw transfer]




4GM_A_2(4YQB)
TRMD_HAEIN
[Raw transfer]




4H1_A_2(4YQO)
TRMD_HAEIN
[Raw transfer]




SFG_A_2(4YVH)
TRMD_HAEIN
[Raw transfer]




ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




4H4_A_2(4YQL)
TRMD_HAEIN
[Raw transfer]




4FV_A_2(4YQ8)
TRMD_HAEIN
[Raw transfer]




4GS_A_2(4YQK)
TRMD_HAEIN
[Raw transfer]




4H6_A_2(4YQP)
TRMD_HAEIN
[Raw transfer]




4GY_A_2(4YQG)
TRMD_HAEIN
[Raw transfer]




4HQ_A_2(4YQR)
TRMD_HAEIN
[Raw transfer]




4FX_A_2(4YQ6)
TRMD_HAEIN
[Raw transfer]




58G_A_2(5D9F)
TRMD_HAEIN
[Raw transfer]




4GN_A_2(4YQA)
TRMD_HAEIN
[Raw transfer]




SFG_B_5(4YVK)
TRMD_HAEIN
[Raw transfer]




SFG_B_5(4YVI)
TRMD_HAEIN
[Raw transfer]




EFW_A_2(4YQC)
TRMD_HAEIN
[Raw transfer]




4GZ_A_2(4YQD)
TRMD_HAEIN
[Raw transfer]




SFG_B_5(4YVJ)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVK)
TRMD_HAEIN
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




4GT_A_2(4YQJ)
TRMD_HAEIN
[Raw transfer]




4GO_A_2(4YQ9)
TRMD_HAEIN
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




4H3_A_2(4YQN)
TRMD_HAEIN
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




4H8_A_2(4YQT)
TRMD_HAEIN
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVI)
TRMD_HAEIN
[Raw transfer]




4FM_A_2(4YQ0)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVJ)
TRMD_HAEIN
[Raw transfer]




4FG_A_2(4YPX)
TRMD_HAEIN
[Raw transfer]




4H9_A_2(4YQS)
TRMD_HAEIN
[Raw transfer]




4FN_A_2(4YQ1)
TRMD_HAEIN
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




4FL_A_2(4YPZ)
TRMD_HAEIN
[Raw transfer]




EFY_A_2(4YQ2)
TRMD_HAEIN
[Raw transfer]




4F9_A_2(4YPY)
TRMD_HAEIN
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




EDO_A_3(3QUV)
?
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




35 PsiBlast_CBE 90.3448% -90 - C7 -4YVK 5.6 TRMD_HAEIN
40 PsiBlast_CBE 90.3248% -97 - C7 -4YVI 6.8 TRMD_HAEIN
48 PsiBlast_CBE 90.1948% -89 - C7 -4MCB 6.6 TRMD_HAEIN
68 HHSearch 90.0848% -90 - C7 -4MCB 6.6 TRMD_HAEIN
50 PsiBlast_CBE 89.6747% -99 - C7 -1P9P 6.4 TRMD_ECOLI
3 PsiBlast_PDB 89.6548% -97 - C7 -1UAL 6.0 TRMD_HAEIN
41 PsiBlast_CBE 89.6048% -98 - C7 -4YVH 6.8 TRMD_HAEIN
37 PsiBlast_CBE 89.5948% -89 - C7 -4YVJ 5.5 TRMD_HAEIN
39 PsiBlast_CBE 89.5348% -88 - C7 -4YVI 6.1 TRMD_HAEIN
2 PsiBlast_PDB 89.1848% -94 - C7 -1UAK - TRMD_HAEIN -
45 PsiBlast_CBE 89.1248% -98 - C7 -4MCD 5.5 TRMD_HAEIN
4 PsiBlast_PDB 89.0848% -85 - C7 -1UAM 6.4 TRMD_HAEIN
43 PsiBlast_CBE 89.0748% -86 - C7 -4YQD 7.9 TRMD_HAEIN
13 PsiBlast_PDB 88.8548% -96 - C7 -4YQ4 5.9 TRMD_HAEIN
46 PsiBlast_CBE 88.4048%-103 - C7 -4MCC 6.1 TRMD_HAEIN
34 PsiBlast_CBE 88.3548% -98 - C7 -4YQ8 4.9 TRMD_HAEIN
36 PsiBlast_CBE 88.2848% -89 - C7 -4YVK 7.0 TRMD_HAEIN
7 PsiBlast_PDB 88.2448% -94 - C7 -4YPY 4.3 TRMD_HAEIN
44 PsiBlast_CBE 88.0448% -98 - C7 -3AXZ 5.5 TRMD_HAEIN
17 PsiBlast_PDB 87.9448% -94 - C7 -4YQ9 5.5 TRMD_HAEIN
27 PsiBlast_CBE 87.8548% -96 - C7 -4YQO 5.8 TRMD_HAEIN
19 PsiBlast_PDB 87.8448% -97 - C7 -4YQB 5.0 TRMD_HAEIN
26 PsiBlast_CBE 87.7948% -98 - C7 -4YQP 5.0 TRMD_HAEIN
51 PsiBlast_CBE 87.7847%-125 - C7 -4IG6 7.1 TRMD_ANAPZ
30 PsiBlast_CBE 87.7648% -94 - C7 -4YQK 4.2 TRMD_HAEIN
24 PsiBlast_CBE 87.6448% -96 - C7 -4YQR 5.5 TRMD_HAEIN
28 PsiBlast_CBE 87.5648% -95 - C7 -4YQN 4.3 TRMD_HAEIN
38 PsiBlast_CBE 87.4648% -87 - C7 -4YVJ 6.9 TRMD_HAEIN
5 PsiBlast_PDB 87.4248% -98 - C7 -4YPW 4.3 TRMD_HAEIN
14 PsiBlast_PDB 87.3548% -99 - C7 -4YQ5 4.9 TRMD_HAEIN
32 PsiBlast_CBE 87.3348% -97 - C7 -4YQI 4.5 TRMD_HAEIN
22 PsiBlast_CBE 87.3248% -95 - C7 -4YQT 5.6 TRMD_HAEIN
8 PsiBlast_PDB 87.3148% -96 - C7 -4YPZ 4.0 TRMD_HAEIN
29 PsiBlast_CBE 87.2848% -96 - C7 -4YQL 4.3 TRMD_HAEIN
20 PsiBlast_PDB 87.2748% -96 - C7 -4YQC 5.2 TRMD_HAEIN
16 PsiBlast_PDB 87.2548% -94 - C7 -4YQ7 6.1 TRMD_HAEIN
33 PsiBlast_CBE 87.1648% -96 - C7 -4YQG 4.8 TRMD_HAEIN
6 PsiBlast_PDB 87.1548% -95 - C7 -4YPX 4.0 TRMD_HAEIN
15 PsiBlast_PDB 87.1048% -97 - C7 -4YQ6 4.5 TRMD_HAEIN
9 PsiBlast_PDB 87.1048% -97 - C7 -4YQ0 5.5 TRMD_HAEIN
77 HHSearch 87.0247%-126 - C7 -3QUV 2.9 ?
18 PsiBlast_PDB 86.9848% -94 - C7 -4YQA 5.3 TRMD_HAEIN
10 PsiBlast_PDB 86.9348% -90 - C7 -4YQ1 9.0 TRMD_HAEIN
21 PsiBlast_CBE 86.9148% -93 - C7 -5D9F 6.2 TRMD_HAEIN
11 PsiBlast_PDB 86.8748% -94 - C7 -4YQ2 8.4 TRMD_HAEIN
31 PsiBlast_CBE 86.8448% -97 - C7 -4YQJ 5.2 TRMD_HAEIN
23 PsiBlast_CBE 86.8048% -95 - C7 -4YQS 5.7 TRMD_HAEIN
25 PsiBlast_CBE 86.7048% -97 - C7 -4YQQ 6.4 TRMD_HAEIN
75 HHSearch 85.6547%-119 - C7 -4IG6 7.1 TRMD_ANAPZ
52 PsiBlast_CBE 85.1745%-116 - C7 -3QUV 2.9 ?
53 PsiBlast_CBE 82.6945%-125 - C7 -3QUV 3.2 ?
49 PsiBlast_CBE 82.3748%-111 - C7 -4MCB 6.4 TRMD_HAEIN
47 PsiBlast_CBE 82.0348%-118 - C7 -4MCC 6.2 TRMD_HAEIN
59 Fugue 78.8446% 18 - C7 -1UAL 6.0 TRMD_HAEIN