@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U467: (2017-12-26 )
MEATYSFTSQLSQGDGFKTLEEGQAVTFDVEESDRGPQAANVVKA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_5(1C9O)
CSPB_BACCL
[Raw transfer]




GOL_A_8(3ULJ)
?
[Raw transfer]




MPD_B_7(2HAX)
CSPB_BACCL
[Raw transfer]




NACID_C_1(2HAX)
CSPB_BACCL
[Raw transfer]

-

47 HHSearch 73.7451% -82 * C7 *1C9O Error CSPB_BACCL
64 HHSearch 68.3551% -80 - C7 -5JX4 - CSPB_BACCL -
23 PsiBlast_CBE 67.9971% -58 - C7 -2HAX - CSPB_BACCL -
2 PsiBlast_PDB 67.2884% 19 - C7 -2LXK - CSPA_LISMO -
5 PsiBlast_PDB 66.7175% -11 - C7 -2ES2 - CSPB_BACSU -
15 PsiBlast_PDB 66.6271% -56 - C7 -2HAX - CSPB_BACCL -
48 HHSearch 66.4051% -72 - C7 -2HAX 4.2 CSPB_BACCL
3 PsiBlast_PDB 66.2275% 0 - C- -1HZ9 - CSPB_BACCL -
1 PsiBlast_PDB 66.0884% 9 - C7 -2LXJ - CSPA_LISMO -
11 PsiBlast_PDB 65.4175% 8 - C7 -3PF4 - CSPB_BACSU -
18 PsiBlast_PDB 65.3771% -8 - C7 -2I5M - CSPB_BACSU -
12 PsiBlast_PDB 65.1675% 22 - C7 -3PF5 - CSPB_BACSU -
19 PsiBlast_PDB 64.2668% -4 - C- -1HZA - CSPB_BACCL -
17 PsiBlast_PDB 64.2276% -53 - C7 -2I5L - CSPB_BACSU -
8 PsiBlast_PDB 64.2175% 15 - C7 -1CSQ - CSPB_BACSU -
4 PsiBlast_PDB 64.1575% 8 - C7 -1HZC - CSPB_BACCL -
7 PsiBlast_PDB 64.1475% 22 - C7 -1CSP - CSPB_BACSU -
49 HHSearch 64.0247% -84 - C7 -3CAM - ? -
14 PsiBlast_PDB 63.7971% -6 - C7 -1C9O - CSPB_BACCL -
13 PsiBlast_PDB 63.5371% -3 - C7 -1I5F - CSPB_BACCL -