@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XWG8: (2017-12-30 )
MTKILFVCLGNICRSPMAEGLLRKRIALEGREAEFFVDSAATSTYEVGKTPHPGTKKILNQEKVDMTNMVARQITPHDFETFDWIIGMDQENVEELKRRAPRSAQGKIHLFLSSIPGKEKENVPDPYYTNNFDETYHLITEGLNHWWNIWIDENKITNNL

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPO_B_8(4LRQ)
?
[Raw transfer]




MPO_C_11(4LRQ)
?
[Raw transfer]




MPO_D_14(4LRQ)
?
[Raw transfer]




MPO_A_5(4LRQ)
?
[Raw transfer]




MPO_B_8(4LRQ)
?
[Raw transfer]




6VY_A_2(5KQL)
PPAC_HUMAN
[Raw transfer]




EPE_A_3(3IDO)
?
[Raw transfer]




PMS_A_5(4Z9A)
PPAC_HUMAN
[Raw transfer]




MES_A_2(5KQM)
PPAC_HUMAN
[Raw transfer]




4NP_D_4(1D1Q)
PPAL_YEAST
[Raw transfer]




4NP_D_4(1D1Q)
PPAL_YEAST
[Raw transfer]




EPE_A_2(5JNV)
PPAC_BOVIN
[Raw transfer]




6VY_A_2(5KQL)
PPAC_HUMAN
[Raw transfer]




6VX_A_2(5KQG)
PPAC_HUMAN
[Raw transfer]




EPE_B_2(1DG9)
PPAC_BOVIN
[Raw transfer]




EPE_A_3(3JS5)
?
[Raw transfer]




EPE_B_4(3IDO)
?
[Raw transfer]




MES_B_2(5PNT)
PPAC_HUMAN
[Raw transfer]




B85_A_2(4Z9B)
PPAC_HUMAN
[Raw transfer]




MES_A_2(5JNT)
PPAC_HUMAN
[Raw transfer]




MES_A_2(5JNT)
PPAC_HUMAN
[Raw transfer]




EPE_C_3(1D1P)
PPAL_YEAST
[Raw transfer]




6LJ_A_3(5JNW)
PPAC_BOVIN
[Raw transfer]




ADE_B_6(1D2A)
PPAL_YEAST
[Raw transfer]




102 HHSearch 91.4838% -68 - C7 -5KQL 7.3 PPAC_HUMAN
3 PsiBlast_PDB 90.9842% -74 - C7 -2CWD - ? -
104 HHSearch 89.3841% -89 - C7 -4ETM - YFKJ_BACSU -
101 HHSearch 89.0233%-118 - C7 -2FEK - WZB_ECOLI -
97 HHSearch 88.4441% -68 - C7 -2CWD - ? -
98 HHSearch 88.1041% -70 - C7 -2CWD - ? -
103 HHSearch 88.0238% -49 - C7 -5JNT 4.0 PPAC_HUMAN
91 HHSearch 87.2634% -69 * C7 *1Z12 - PPAC_BOVIN -
44 PsiBlast_CBE 85.5832% -82 - C7 -3IDO 4.4 ?
43 PsiBlast_CBE 85.4932% -77 - C7 -3IDO 4.4 ?
1 PsiBlast_PDB 85.3642%-105 - C7 -4ETM - YFKJ_BACSU -
88 HHSearch 85.1538% -73 - C7 -4LRQ 4.6 ?
12 PsiBlast_PDB 84.6443% -84 - C7 -5PNT 3.5 PPAC_HUMAN
34 PsiBlast_CBE 84.5740% -77 - C7 -1DG9 4.7 PPAC_BOVIN
4 PsiBlast_PDB 84.3843% -77 - C7 -5JNU - PPAC_MOUSE -
17 PsiBlast_PDB 84.3443% -76 - C7 -5KQM 3.9 PPAC_HUMAN
8 PsiBlast_PDB 84.0543% -80 - C7 -4Z9A 4.2 PPAC_HUMAN
6 PsiBlast_PDB 83.9543% -82 - C7 -5JNT 4.0 PPAC_HUMAN
89 HHSearch 83.7036% -88 - C7 -3ROF - PTPA_STAAU -
42 PsiBlast_CBE 83.5832% -83 - C7 -3JS5 4.5 ?
15 PsiBlast_PDB 83.4243% -77 - C7 -5KQG 7.4 PPAC_HUMAN
16 PsiBlast_PDB 82.9043% -84 - C7 -5KQL 7.2 PPAC_HUMAN
9 PsiBlast_PDB 82.1943% -74 - C7 -4Z9B 5.4 PPAC_HUMAN
20 PsiBlast_PDB 82.0541% -80 - C7 -5JNW 4.8 PPAC_BOVIN
19 PsiBlast_PDB 81.1941% -75 - C7 -5JNV 3.8 PPAC_BOVIN
27 PsiBlast_CBE 79.5144% -60 - C7 -4LRQ 5.0 ?
26 PsiBlast_CBE 79.3444% -59 - C7 -4LRQ 5.0 ?
14 PsiBlast_PDB 79.1144% -61 - C7 -4LRQ 4.8 ?
28 PsiBlast_CBE 77.4344% -63 - C7 -4LRQ 4.6 ?
46 PsiBlast_CBE 72.3535% -6 - C7 -1D1P 3.5 PPAL_YEAST
48 PsiBlast_CBE 71.3534% 5 - C7 -1D1Q 4.4 PPAL_YEAST
94 HHSearch 70.5531% 19 - C7 -1D1Q 4.4 PPAL_YEAST