@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XWK4: (2017-12-30 )
MTKSKPIIIGVTGGSGSGKTSVSRAIFNNFPDHSIMMLEQDSYYKDQSHLSFEERLNTNYDHPFAFDNDLLIQHVGDLLNYKAIEKPVYDYVAHTRSQATIIQEPKEVIILEGILILEDERLRDLMDIKVYVDTDDDIRIIRRIKRDMEERGRTLDSVIEQYLTVVKPMYHQFIEPTKRYADIIVPEGGENHVAIDLITTKVASFLNHK

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTP_D_4(1UDW)
UCK2_HUMAN
[Raw transfer]




CTP_C_3(1UDW)
UCK2_HUMAN
[Raw transfer]




UTP_C_3(1UEI)
UCK2_HUMAN
[Raw transfer]




UTP_D_4(1UEI)
UCK2_HUMAN
[Raw transfer]




C5P_B_7(1UJ2)
UCK2_HUMAN
[Raw transfer]




C5P_A_5(1XRJ)
UCK2_HUMAN
[Raw transfer]




C5P_A_3(3ASZ)
URK_THET8
[Raw transfer]




C5P_A_5(1UJ2)
UCK2_HUMAN
[Raw transfer]




C5P_B_4(3ASZ)
URK_THET8
[Raw transfer]




C5P_B_4(3ASZ)
URK_THET8
[Raw transfer]




C5P_B_7(1UJ2)
UCK2_HUMAN
[Raw transfer]




ACP_B_6(3W34)
URK_THET8
[Raw transfer]




ACP_B_6(3W34)
URK_THET8
[Raw transfer]




ACP_A_4(3W34)
URK_THET8
[Raw transfer]




CTN_D_4(1UEJ)
UCK2_HUMAN
[Raw transfer]




CTN_C_3(1UEJ)
UCK2_HUMAN
[Raw transfer]




CIT_F_6(1UEJ)
UCK2_HUMAN
[Raw transfer]




ACP_B_6(3W8R)
URK_THET8
[Raw transfer]




ADP_B_8(1XRJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1XRJ)
UCK2_HUMAN
[Raw transfer]




CIT_E_5(1UEJ)
UCK2_HUMAN
[Raw transfer]




ACP_A_4(3W8R)
URK_THET8
[Raw transfer]




55 HHSearch 95.6150%-111 - C1 -3W34 3.9 URK_THET8
56 HHSearch 94.6350%-104 - C1 -3ASZ 6.6 URK_THET8
21 PsiBlast_CBE 89.5052% -96 - C1 -3W8R 3.3 URK_THET8
4 PsiBlast_PDB 89.1552% -92 - C1 -3W34 3.4 URK_THET8
3 PsiBlast_PDB 88.7852% -99 - C1 -3ASZ 7.7 URK_THET8
22 PsiBlast_CBE 88.3852%-100 - C1 -3W34 3.9 URK_THET8
23 PsiBlast_CBE 87.1752% -92 - C1 -3ASZ 6.6 URK_THET8
2 PsiBlast_PDB 86.7552%-103 - C1 -3ASY - URK_THET8 -
1 PsiBlast_PDB 86.6352% -93 - C1 -3W8R 2.5 URK_THET8
5 PsiBlast_PDB 75.5339% 10 - C1 -1XRJ 9.5 UCK2_HUMAN
11 PsiBlast_PDB 75.2538% -6 - C1 -2JEO - UCK1_HUMAN -
12 PsiBlast_PDB 74.6138% -8 - C1 -2UVQ - UCK1_HUMAN -
9 PsiBlast_PDB 74.0939% 15 - C1 -1UFQ - UCK2_HUMAN -
24 PsiBlast_CBE 74.0139% 7 - C1 -1XRJ 5.4 UCK2_HUMAN
8 PsiBlast_PDB 73.6439% 27 - C1 -1UEJ 6.9 UCK2_HUMAN
10 PsiBlast_PDB 73.5639% 7 - C1 -1UJ2 8.5 UCK2_HUMAN
62 HHSearch 73.5140% 30 - C1 -2JEO - UCK1_HUMAN -
25 PsiBlast_CBE 73.3139% 11 - C1 -1UJ2 9.1 UCK2_HUMAN
61 HHSearch 72.4742% 7 - C1 -1UJ2 9.1 UCK2_HUMAN
7 PsiBlast_PDB 72.3439% 2 - C1 -1UEI 9.8 UCK2_HUMAN
26 PsiBlast_CBE 72.2339% 34 - C1 -1UEJ 7.2 UCK2_HUMAN
6 PsiBlast_PDB 72.1939% 6 - C1 -1UDW 9.7 UCK2_HUMAN
27 PsiBlast_CBE 71.7939% 27 - C1 -1UEI 10.1 UCK2_HUMAN
28 PsiBlast_CBE 69.3939% 31 - C1 -1UDW 10.2 UCK2_HUMAN