@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XWT1: (2017-12-31 )
MLRKQKTMEALETMYGMFPEAHGELKHNNPFELLIAVILSAQATDVSVNKATPDLFASFPTPDALAEASIDEIILKIKTIGLYRNKAKNIKACAQQLIERFDGQVPTSREELMSLPGVGRKTANVVLGDAFGIPAIAVDTHVERVSKRLRICKLDATVMEVEETLMRKVPQELWVKTHHTLIFFGRYHCTARNPKCEVCPLLSICQDGKNRMRLKEKALKKKPRL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_2(1P59)
?
[Raw transfer]

-

NACID_C_2(1ORN)
?
[Raw transfer]

-

NACID_C_2(1ORN)
?
[Raw transfer]

-

NACID_C_2(1ORP)
?
[Raw transfer]

-

NACID_B_1(1P59)
?
[Raw transfer]

-

NACID_B_1(1ORN)
?
[Raw transfer]

-

2 PsiBlast_PDB 96.3958%-141 - C3 -1ORN 8.7 ?
1 PsiBlast_PDB 95.8558%-138 - C3 -1P59 9.1 ?
3 PsiBlast_PDB 95.1558%-139 - C3 -1ORP 8.5 ?
22 HHSearch 94.9158%-136 - C3 -1ORN 8.7 ?
21 HHSearch 89.9649%-137 - C3 -2ABK - END3_ECOLI -
4 PsiBlast_PDB 89.7349%-147 - C3 -2ABK - END3_ECOLI -
12 PsiBlast_PDB 65.3729% -94 - C3 -1VRL - MUTY_GEOSE -
8 PsiBlast_PDB 64.8630% -97 - C3 -4YPH - MUTY_GEOSE -
20 PsiBlast_PDB 64.3429% -99 - C3 -1WEF - MUTY_ECOLI -
18 PsiBlast_PDB 64.0729%-106 - C3 -1KG2 - MUTY_ECOLI -
9 PsiBlast_PDB 64.0030% -95 - C3 -3G0Q - MUTY_GEOSE -
14 PsiBlast_PDB 63.8829% -94 - C3 -1RRQ - MUTY_GEOSE -
16 PsiBlast_PDB 63.8329%-108 - C3 -1KG5 - MUTY_ECOLI -
19 PsiBlast_PDB 63.4529%-107 - C3 -1KG3 - MUTY_ECOLI -
10 PsiBlast_PDB 63.2429% -97 - C3 -5KN9 - MUTY_GEOSE -
17 PsiBlast_PDB 63.0129%-103 - C3 -1MUY - MUTY_ECOLI -
7 PsiBlast_PDB 62.8730% -88 - C3 -4YOQ - MUTY_GEOSE -
13 PsiBlast_PDB 62.6029%-100 - C3 -5KN8 - MUTY_GEOSE -
5 PsiBlast_PDB 61.5030% -92 - C3 -3FSP - MUTY_GEOSE -
46 Fugue 61.3524% -73 - C3 -1RRQ - MUTY_GEOSE -