@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XWZ1: (2018-01-01 )
MVEMALKNVYKKYDNAENYSVTDFNLSIKDREFIVFVGPSGCGKSTTLRMIAGLEDISEGELNIGGKVMNDVAPKDRDIAMVFQNYALYPHMTVFDNMAFGLKLRKYDKADIKKRVDNAAEILGLTEYLKRKPAALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKLHQRLETTTIYVTHDQTEAMTMADRIVIMKDGFIQQIGTPKEVYDTPVNMFVAGFIGSPAMNFFNVTLKNGVITDGHGLKLRIPEGKNKVLVEKGYEGKEVIFGIRPEDIHSEQVALEASPEAVVKSEVVVSELLGAETMLYTKTGSTEFISKVDARDFHKPGEIVDLAFNISKGHFFDKETEQVIKLP

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




POP_A_9(2D62)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




POP_A_9(2D62)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




IPA_A_6(3TIF)
Y796_METJA
[Raw transfer]




7 PsiBlast_PDB 89.5550%-111 - C2 -1V43 - ? -
113 HHSearch 87.2951% -96 - C2 -1V43 - ? -
6 PsiBlast_PDB 86.0850%-106 - C2 -1VCI 4.2 ?
4 PsiBlast_PDB 84.4051% -80 - C2 -4XTC - ? -
3 PsiBlast_PDB 84.0651% -79 - C2 -4XIG - ? -
1 PsiBlast_PDB 83.7851% -79 - C2 -4TQU - ? -
106 HHSearch 82.3943%-113 - C2 -2IT1 - ? -
17 PsiBlast_PDB 81.4550%-104 - C2 -3PUV - MALK_ECOLI -
20 PsiBlast_PDB 80.9650%-104 - C2 -3RLF - MALK_ECOLI -
99 HHSearch 80.9352% -78 - C2 -4TQU - ? -
97 HHSearch 80.8347% -86 - C2 -3RLF - MALK_ECOLI -
19 PsiBlast_PDB 80.6150%-104 - C2 -3PUX - MALK_ECOLI -
22 PsiBlast_CBE 80.5650%-102 - C2 -4KI0 - MALK_ECOLI -
18 PsiBlast_PDB 80.3950%-102 - C2 -3PUW - MALK_ECOLI -
14 PsiBlast_PDB 80.0850%-103 - C2 -3PUY - MALK_ECOLI -
34 PsiBlast_CBE 79.9850% -99 - C2 -2R6G - MALK_ECOLI (first) -
24 PsiBlast_CBE 79.4050%-108 - C2 -3PUZ - MALK_ECOLI -
23 PsiBlast_CBE 78.6850%-103 - C2 -3RLF - MALK_ECOLI -
21 PsiBlast_CBE 78.0050%-103 - C2 -4KI0 - MALK_ECOLI -
33 PsiBlast_CBE 77.7850%-105 - C2 -2R6G - MALK_ECOLI (first) -
102 HHSearch 75.7255% 19 - C2 -2D62 3.0 ?
5 PsiBlast_PDB 75.1451% 19 - C2 -2D62 3.0 ?
79 PsiBlast_CBE 42.1033% -10 - C2 -4YMV 4.6 ?
60 PsiBlast_CBE 41.3935% -16 - C2 -3C41 3.6 ?
80 PsiBlast_CBE 40.2133% -14 - C2 -4YMU 5.6 ?
62 PsiBlast_CBE 39.7435% -13 - C2 -3C4J 3.2 ?
61 PsiBlast_CBE 39.6335% -13 - C2 -3C41 5.1 ?
78 PsiBlast_CBE 39.5133% -12 - C2 -4YMV 5.0 ?
81 PsiBlast_CBE 39.2933% -14 - C2 -4YMU 5.7 ?
70 PsiBlast_CBE 39.2035% -14 - C2 -2OLK 4.0 ?
65 PsiBlast_CBE 38.9935% -14 - C2 -2Q0H 3.3 ?
72 PsiBlast_CBE 38.8135% -13 - C2 -2OLK 3.7 ?
75 PsiBlast_CBE 38.1135% -8 - C2 -2OLJ 3.9 ?
64 PsiBlast_CBE 37.9735% -16 - C2 -2Q0H 3.6 ?
63 PsiBlast_CBE 37.9535% -14 - C2 -3C4J 4.7 ?
74 PsiBlast_CBE 37.6335% -11 - C2 -2OLJ 3.5 ?
73 PsiBlast_CBE 37.1035% -15 - C2 -2OLK 3.7 ?
71 PsiBlast_CBE 36.8035% -16 - C2 -2OLK 4.2 ?
84 PsiBlast_CBE 35.3535% 28 - C2 -3TIF 3.8 Y796_METJA
86 PsiBlast_CBE 23.0831% 25 - C2 -1B0U 3.4 HISP_SALTY