@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XX07: (2018-01-01 )
MRKPIIAGNWKMNKTASEAKEFAEAVKNKIPSNDKVDSVIGSPALFLQELMTSAEGTELKISAQNCYWENSGAFTGETSPAALADLGVHYVIIGHSERREYFHETDEDINKKAKAIFANGMTPILCCGESLETYEAGKTAEWIEGQITAGLADLSAEQVSNMVIAYEPIWAIGTGKSADAQIADEICGVVRQTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQADSFLSLLDAVK

Atome Classification :

(85 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G3P_B_5(3UWU)
TPIS_STAAR
[Raw transfer]




G3P_A_3(3UWU)
TPIS_STAAR
[Raw transfer]




PGA_A_3(1BTM)
TPIS_GEOSE
[Raw transfer]




PGH_A_3(3TAO)
TPIS_MYCTU
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




3PG_A_3(2VFI)
TPIS_PLAFA
[Raw transfer]




PGH_B_4(7TIM)
TPIS_YEAST
[Raw transfer]




PGA_C_3(1AMK)
TPIS_LEIME
[Raw transfer]




G2H_A_3(3UWZ)
TPIS_STAAR
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_A_2(1LYX)
TPIS_PLAFA
[Raw transfer]




PGA_D_4(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_B_4(5EYW)
?
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_B_4(2YPI)
TPIS_YEAST
[Raw transfer]




PGA_A_2(1N55)
TPIS_LEIME
[Raw transfer]




13P_B_14(4YMZ)
TPIS_LEPIN
[Raw transfer]




PGA_A_3(5EYW)
?
[Raw transfer]




PGA_C_3(1QDS)
TPIS_LEIME
[Raw transfer]




PGA_B_4(1BTM)
TPIS_GEOSE
[Raw transfer]




3PG_A_3(2VFH)
TPIS_PLAFA
[Raw transfer]




13P_A_3(4YMZ)
TPIS_LEPIN
[Raw transfer]




PGA_A_3(2YPI)
TPIS_YEAST
[Raw transfer]




PGH_A_3(7TIM)
TPIS_YEAST
[Raw transfer]




3PG_B_4(2VFH)
TPIS_PLAFA
[Raw transfer]




PGA_A_2(4BI6)
TPI1_GIAIN
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




3PG_C_3(1M7O)
TPIS_PLAFA
[Raw transfer]




PGA_A_3(4FF7)
TPIS_YEAST
[Raw transfer]




3PG_B_6(3UWW)
TPIS_STAAR
[Raw transfer]




3PG_B_5(2VFI)
TPIS_PLAFA
[Raw transfer]




PGA_A_2(4BI7)
TPI1_GIAIN
[Raw transfer]




1GP_A_2(2Y61)
TPIS_LEIME
[Raw transfer]




PGA_F_6(1LZO)
TPIS_PLAFA
[Raw transfer]




G3P_A_2(2Y62)
TPIS_LEIME
[Raw transfer]




3PG_D_4(1M7O)
TPIS_PLAFA
[Raw transfer]




PGH_A_3(3YPI)
TPIS_YEAST
[Raw transfer]




BBR_A_2(2Y63)
TPIS_LEIME
[Raw transfer]




G3H_D_4(1M7P)
TPIS_PLAFA
[Raw transfer]




G3H_C_3(1M7P)
TPIS_PLAFA
[Raw transfer]




3PG_A_4(3UWW)
TPIS_STAAR
[Raw transfer]




GOL_A_4(2VFE)
TPIS_PLAFA
[Raw transfer]




GOL_A_3(3GVG)
TPIS_MYCTU
[Raw transfer]




PGH_B_4(3YPI)
TPIS_YEAST
[Raw transfer]




PGA_E_5(1LZO)
TPIS_PLAFA
[Raw transfer]




PGH_B_4(3YPI)
TPIS_YEAST
[Raw transfer]




GOL_B_6(2VFE)
TPIS_PLAFA
[Raw transfer]




G2H_B_5(3UWZ)
TPIS_STAAR
[Raw transfer]




GOL_B_5(3GVG)
TPIS_MYCTU
[Raw transfer]




TRS_H_8(2I9E)
?
[Raw transfer]




2PG_A_5(3UWV)
TPIS_STAAR
[Raw transfer]




2PG_B_7(3UWV)
TPIS_STAAR
[Raw transfer]




GOL_B_18(4FF7)
TPIS_YEAST
[Raw transfer]




2PG_B_5(1O5X)
TPIS_PLAFA
[Raw transfer]




UVW_A_4(4MVA)
?
[Raw transfer]




CIT_B_5(3M9Y)
TPIS_STAAR
[Raw transfer]




CIT_B_5(3M9Y)
TPIS_STAAR
[Raw transfer]




3PY_A_4(1O5X)
TPIS_PLAFA
[Raw transfer]




EDO_B_12(5BMW)
TPIS_PLAFA
[Raw transfer]




EDO_A_4(4ZZ9)
TPIS_PLAFA
[Raw transfer]




EDO_B_9(4YWI)
TPIS_PLAFA
[Raw transfer]




EDO_B_7(4ZZ9)
TPIS_PLAFA
[Raw transfer]




EDO_A_3(4Z0S)
TPIS_PLAFA
[Raw transfer]




EDO_A_4(3PSV)
TPIS_PLAFA
[Raw transfer]




PEG_B_9(4MVA)
?
[Raw transfer]




EDO_A_3(3PSW)
TPIS_PLAFA
[Raw transfer]




EDO_B_7(3PSW)
TPIS_PLAFA
[Raw transfer]




EDO_B_16(4Z0J)
TPIS_PLAFA
[Raw transfer]




EDO_B_16(4Z0J)
TPIS_PLAFA
[Raw transfer]




EDO_A_5(4YXG)
TPIS_PLAFA
[Raw transfer]




MRD_A_2(4MKN)
?
[Raw transfer]




TRS_I_9(2I9E)
?
[Raw transfer]




1 PsiBlast_PDB 94.0867%-104 - C6 -5IBX - TPIS_STRP2 -
139 HHSearch 90.9067% -94 - C6 -5IBX - TPIS_STRP2 -
9 PsiBlast_PDB 90.2556% -96 - C6 -1BTM 3.3 TPIS_GEOSE
8 PsiBlast_PDB 90.1657% -99 - C6 -2BTM 4.0 TPIS_GEOSE
143 HHSearch 90.0453%-107 - C6 -4Y8F - TPIS_CLOPE -
156 HHSearch 90.0357% -97 - C6 -2BTM 4.0 TPIS_GEOSE
30 PsiBlast_CBE 90.0157% -96 - C6 -2BTM 3.1 TPIS_GEOSE
10 PsiBlast_PDB 89.9353%-106 - C6 -4Y8F - TPIS_CLOPE -
31 PsiBlast_CBE 88.7756% -96 - C6 -1BTM 3.2 TPIS_GEOSE
142 HHSearch 88.6246%-116 - C6 -1B9B - -
11 PsiBlast_PDB 85.9446%-107 - C6 -1B9B - PGKT_THEMA -
71 PsiBlast_CBE 83.8143%-105 - C6 -2I9E - ? -
72 PsiBlast_CBE 83.7543%-104 - C6 -2I9E 3.0 ?
138 HHSearch 83.6643%-101 - C6 -4Y96 - ? -
73 PsiBlast_CBE 83.5843%-104 - C6 -2I9E - ? -
16 PsiBlast_PDB 83.5343%-106 - C6 -4Y96 - ? -
85 PsiBlast_CBE 83.4039%-108 - C6 -2Y63 3.1 TPIS_LEIME
90 PsiBlast_CBE 83.3239%-107 - C6 -1N55 3.4 TPIS_LEIME
87 PsiBlast_CBE 83.2939%-105 - C6 -2Y61 3.7 TPIS_LEIME
70 PsiBlast_CBE 83.2543%-103 - C6 -2I9E 2.9 ?
86 PsiBlast_CBE 83.1039%-106 - C6 -2Y62 3.7 TPIS_LEIME
91 PsiBlast_CBE 82.9339%-103 - C6 -1IF2 4.4 TPIS_LEIME
4 PsiBlast_PDB 82.8760% -14 - C6 -3UWV 2.7 TPIS_STAAR
88 PsiBlast_CBE 82.7839%-107 - C6 -2VXN 4.3 TPIS_LEIME
41 PsiBlast_CBE 82.7643%-102 - C6 -4MVA 3.7 ?
5 PsiBlast_PDB 82.6960% -15 - C6 -3UWW 3.8 TPIS_STAAR
89 PsiBlast_CBE 82.5939%-105 - C6 -1QDS 4.1 TPIS_LEIME
28 PsiBlast_CBE 82.3560% -15 - C6 -3UWV 3.2 TPIS_STAAR
148 HHSearch 82.2239%-103 - C6 -2VXN 4.3 TPIS_LEIME
25 PsiBlast_CBE 82.1960% -14 - C6 -3M9Y 2.0 TPIS_STAAR
40 PsiBlast_CBE 82.1443%-104 - C6 -4MVA 2.0 ?
100 PsiBlast_CBE 81.8639%-101 - C6 -1AMK 4.2 TPIS_LEIME
7 PsiBlast_PDB 81.8360% -14 - C6 -3UWZ 2.2 TPIS_STAAR
29 PsiBlast_CBE 81.5060% -10 - C6 -3UWU 4.1 TPIS_STAAR
3 PsiBlast_PDB 81.4060% -9 - C6 -3UWU 4.3 TPIS_STAAR
154 HHSearch 81.0860% -12 - C6 -3M9Y 2.0 TPIS_STAAR
26 PsiBlast_CBE 80.8360% -17 - C6 -3UWZ 2.1 TPIS_STAAR
27 PsiBlast_CBE 80.6460% -9 - C6 -3UWW 3.3 TPIS_STAAR
155 HHSearch 80.3436%-100 - C6 -4MKN 2.8 ?
141 HHSearch 78.8539% -90 - C6 -3YPI 3.4 TPIS_YEAST
159 Fugue 78.5656% -5 - C6 -2BTM 4.0 TPIS_GEOSE
149 HHSearch 75.9038% -92 - C6 -4Z0J 3.2 TPIS_PLAFA
37 PsiBlast_CBE 72.5843% 13 - C6 -4YMZ 3.7 TPIS_LEPIN
19 PsiBlast_PDB 72.5743% 12 - C6 -4YMZ 3.7 TPIS_LEPIN
77 PsiBlast_CBE 71.8539% -5 - C6 -7TIM 3.6 TPIS_YEAST
160 Fugue 71.6939% -9 - C6 -1IF2 4.4 TPIS_LEIME
35 PsiBlast_CBE 71.5143% -5 - C6 -3GVG 2.9 TPIS_MYCTU
84 PsiBlast_CBE 71.2739% -3 - C6 -4FF7 3.4 TPIS_YEAST
78 PsiBlast_CBE 71.2739% -6 - C6 -7TIM 3.9 TPIS_YEAST
15 PsiBlast_PDB 71.2743% -7 - C6 -3GVG 2.3 TPIS_MYCTU
83 PsiBlast_CBE 71.0239% 1 - C6 -4FF7 2.2 TPIS_YEAST
80 PsiBlast_CBE 69.7939% -5 - C6 -2YPI 3.6 TPIS_YEAST
82 PsiBlast_CBE 69.4439% -7 - C6 -3YPI 4.0 TPIS_YEAST
14 PsiBlast_PDB 68.9343% -0 - C6 -3TAO 4.1 TPIS_MYCTU
81 PsiBlast_CBE 68.8239% -2 - C6 -3YPI 3.4 TPIS_YEAST
105 PsiBlast_CBE 68.6541% -6 - C6 -5EYW 3.6 ?
104 PsiBlast_CBE 68.1741% -3 - C6 -5EYW 3.6 ?
124 PsiBlast_CBE 67.1140% 9 - C6 -4BI7 3.1 TPI1_GIAIN
127 PsiBlast_CBE 67.0341% 12 - C6 -4BI6 3.6 TPI1_GIAIN
79 PsiBlast_CBE 66.9439% 3 - C6 -2YPI 3.8 TPIS_YEAST
137 PsiBlast_CBE 66.5537% -9 - C6 -5BMW 2.7 TPIS_PLAFA
133 PsiBlast_CBE 65.6137% -6 - C6 -4ZZ9 2.5 TPIS_PLAFA
97 PsiBlast_CBE 65.4438% -2 - C6 -2VFE 2.5 TPIS_PLAFA
132 PsiBlast_CBE 65.3637% -8 - C6 -3PSV 2.6 TPIS_PLAFA
134 PsiBlast_CBE 65.2237% -7 - C6 -4ZZ9 2.5 TPIS_PLAFA
117 PsiBlast_CBE 65.1438% -1 - C6 -1M7O 3.8 TPIS_PLAFA
113 PsiBlast_CBE 65.1438% -15 - C6 -1O5X 2.5 TPIS_PLAFA
114 PsiBlast_CBE 65.0738% -2 - C6 -1O5X 3.2 TPIS_PLAFA
128 PsiBlast_CBE 65.0438% -5 - C6 -2VFH 3.0 TPIS_PLAFA
112 PsiBlast_CBE 65.0038% -3 - C6 -2VFI 3.3 TPIS_PLAFA
126 PsiBlast_CBE 64.8737% -5 - C6 -3PSW 2.4 TPIS_PLAFA
116 PsiBlast_CBE 64.7538% -2 - C6 -1M7P 2.1 TPIS_PLAFA
115 PsiBlast_CBE 64.7538% -4 - C6 -1M7P 2.7 TPIS_PLAFA
103 PsiBlast_CBE 64.6138% -2 - C6 -4Z0S 2.7 TPIS_PLAFA
118 PsiBlast_CBE 64.6038% -3 - C6 -1M7O 3.6 TPIS_PLAFA
111 PsiBlast_CBE 64.5338% -1 - C6 -2VFI 3.3 TPIS_PLAFA
125 PsiBlast_CBE 64.1637% -12 - C6 -3PSW 2.3 TPIS_PLAFA
129 PsiBlast_CBE 64.0938% -0 - C6 -2VFH 3.5 TPIS_PLAFA
94 PsiBlast_CBE 63.9038% 2 - C6 -4YWI 2.4 TPIS_PLAFA
121 PsiBlast_CBE 63.8138% 1 - C6 -1LYX 3.1 TPIS_PLAFA
92 PsiBlast_CBE 63.5539% -3 - C6 -4Z0J 3.2 TPIS_PLAFA
120 PsiBlast_CBE 63.1238% -0 - C6 -1LZO 1.8 TPIS_PLAFA
96 PsiBlast_CBE 63.0938% -6 - C6 -2VFE 2.2 TPIS_PLAFA
119 PsiBlast_CBE 62.4338% -3 - C6 -1LZO 1.8 TPIS_PLAFA
122 PsiBlast_CBE 61.4838% -2 - C6 -4YXG 3.0 TPIS_PLAFA