@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XX92: (2018-01-03 )
MAEKILVEHLVKKYGDNTVLNDINVSINEGDVVCIIGPSGSGKSTFLRCLNRLEEPSDGEIIIDGAHLMDKSTDINLVRQHIGMVFQHFNLFPHLSILENIILAPMDLKKESREEAEKKAIKLLQTVGLEDKKDMYPEMLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVGDVLNVMKKLAEQGMTMVIVTHEMGFAKEVANRVMFIDDGNFLEDGTPQQIFENPQNERTKDFLNKVLNI

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ACP_A_4(4AYT)
ABCBA_HUMAN
[Raw transfer]




ACP_A_4(4AYX)
ABCBA_HUMAN
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




1 PsiBlast_PDB 98.6064%-131 * C1 *2OLJ 5.9 ?
26 PsiBlast_CBE 98.2064%-126 - C1 -2OLK 6.4 ?
3 PsiBlast_PDB 97.2664%-130 - C1 -2OUK - ? -
27 PsiBlast_CBE 96.1364%-126 - C1 -2OLK 6.3 ?
5 PsiBlast_PDB 96.0664%-123 - C1 -3C4J 6.9 ?
28 PsiBlast_CBE 95.9464%-124 - C1 -2OLK 6.4 ?
2 PsiBlast_PDB 95.9264%-127 - C1 -2OLK 6.3 ?
21 PsiBlast_CBE 95.5064%-126 - C1 -3C4J 5.1 ?
4 PsiBlast_PDB 95.2964%-124 - C1 -2Q0H 5.7 ?
22 PsiBlast_CBE 95.2764%-129 - C1 -2Q0H 6.1 ?
29 PsiBlast_CBE 95.0664%-122 - C1 -2OLJ 5.8 ?
31 PsiBlast_CBE 93.9462%-130 - C1 -4YMV 5.3 ?
30 PsiBlast_CBE 93.7364%-126 - C1 -3C41 6.1 ?
32 PsiBlast_CBE 93.6562%-135 - C1 -4YMU 6.0 ?
6 PsiBlast_PDB 93.3864%-117 - C1 -3C41 6.7 ?
9 PsiBlast_PDB 93.0662%-130 - C1 -4YMU 5.6 ?
7 PsiBlast_PDB 92.8662%-131 - C1 -4YMS - ? -
11 PsiBlast_PDB 92.4462%-128 - C1 -4YMW - ? -
10 PsiBlast_PDB 91.5362%-132 - C1 -4YMV 5.5 ?
8 PsiBlast_PDB 91.2762%-130 - C1 -4YMT - ? -
12 PsiBlast_PDB 88.7356%-120 - C1 -4U00 6.1 ?
14 PsiBlast_PDB 77.5350% -9 - C1 -1B0U 6.1 HISP_SALTY
125 Fugue 60.4650% 40 - C1 -1B0U 5.9 HISP_SALTY
48 PsiBlast_CBE 56.0544% -2 - C1 -3TIF 4.8 Y796_METJA
46 PsiBlast_CBE 55.5344% 1 - C1 -1L2T 5.4 Y796_METJA
49 PsiBlast_CBE 55.0044% -4 - C1 -3TIF 4.8 Y796_METJA
47 PsiBlast_CBE 54.5444% 1 - C1 -1L2T 5.3 Y796_METJA
117 PsiBlast_CBE 53.5236% -60 - C1 -4AYX 4.1 ABCBA_HUMAN
118 PsiBlast_CBE 51.7336% -59 - C1 -4AYT 4.7 ABCBA_HUMAN
120 PsiBlast_CBE 48.6436% -59 - C1 -4AYW 4.3 ABCBA_HUMAN