@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XXF9: (2018-01-03 )
MITMDDIIREGNPTLREVAKEVSLPLSEEDISLGKEMLEFLKNSQDPIKAEELHLRGGVGLAAPQLDISKRIIAVHVPSPDPEADGPSLSTVMYNPKILSHSVQDACLGEGEGCLSVDREVPGYVVRHAKITVSYYDMNGEKHKIRLKNYESIVVQHEIDHINGVMFYDHINDQNPFALKEGVLVIE

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BB2_A_2(5JF1)
DEF_STRA3
[Raw transfer]




SF5_A_2(5JF3)
DEF_STRA3
[Raw transfer]




6JT_A_2(5JF4)
DEF_STRA3
[Raw transfer]




7JT_A_2(5JF5)
DEF_STRA3
[Raw transfer]




BB2_A_6(2OS1)
DEF_ENTFA
[Raw transfer]




SF7_A_2(5JF2)
DEF_STRA3
[Raw transfer]




PN3_A_2(5JF8)
DEF_STRA3
[Raw transfer]




BB2_A_4(1LQY)
DEF2_GEOSE
[Raw transfer]




BB2_B_7(2OKL)
DEF2_BACCR
[Raw transfer]




BB2_A_3(2OS3)
DEF_STRP1
[Raw transfer]




BB2_A_4(1LQY)
DEF2_GEOSE
[Raw transfer]




BB2_B_7(2OKL)
DEF2_BACCR
[Raw transfer]




SB8_A_4(2AIA)
DEF_STRR6
[Raw transfer]




SB7_A_4(2AI7)
DEF_STRR6
[Raw transfer]




5LI_P_4(3SW8)
?
[Raw transfer]




SB9_P_4(2AIE)
DEF_STRR6
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




BB4_A_2(5JF6)
DEF_STRA3
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_A_8(1VEV)
DEF_LEPIN
[Raw transfer]




6JU_A_2(5JF7)
DEF_STRA3
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




FMT_A_12(1VEZ)
DEF_LEPIN
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




GLY_B_5(1Y6H)
DEF_LEPIN
[Raw transfer]




DTT_A_5(1SV2)
DEF_LEPIN
[Raw transfer]




BB2_B_6(2OKL)
DEF2_BACCR
[Raw transfer]




1 PsiBlast_PDB 98.27100%-115 - C4 -3G6N - ? -
2 PsiBlast_PDB 97.63100%-112 - C4 -3CMD - ? -
3 PsiBlast_PDB 94.5985%-113 - C4 -2OS1 6.4 DEF_ENTFA
4 PsiBlast_PDB 93.8484%-112 - C4 -2OS0 - DEF_ENTFA -
119 HHSearch 91.1498% -51 - C4 -3CMD - ? -
118 HHSearch 86.6484% -37 - C4 -2OS0 - DEF_ENTFA -
23 PsiBlast_CBE 86.2068% -33 - C4 -2OS3 5.7 DEF_STRP1
16 PsiBlast_PDB 84.1267% -27 - C4 -5JF5 4.9 DEF_STRA3
26 PsiBlast_CBE 84.0454%-102 - C4 -1LQY 6.6 DEF2_GEOSE
9 PsiBlast_PDB 83.9467% -24 - C4 -5JEX - DEF_STRA3 -
12 PsiBlast_PDB 83.2067% -25 - C4 -5JF1 5.9 DEF_STRA3
24 PsiBlast_CBE 83.1562% -97 - C4 -2OKL 6.3 DEF2_BACCR
14 PsiBlast_PDB 83.1467% -23 - C4 -5JF3 4.2 DEF_STRA3
13 PsiBlast_PDB 82.9167% -24 - C4 -5JF2 4.3 DEF_STRA3
15 PsiBlast_PDB 82.9067% -25 - C4 -5JF4 4.8 DEF_STRA3
25 PsiBlast_CBE 82.5762% -91 - C4 -2OKL 3.1 DEF2_BACCR
17 PsiBlast_PDB 82.5467% -22 - C4 -5JF6 4.6 DEF_STRA3
19 PsiBlast_PDB 82.3767% -23 - C4 -5JF8 3.6 DEF_STRA3
20 PsiBlast_PDB 82.2867% -21 - C4 -5JF0 - DEF_STRA3 -
8 PsiBlast_PDB 82.0468% -36 - C4 -2AIA 5.8 DEF_STRR6
18 PsiBlast_PDB 80.9367% -22 - C4 -5JF7 4.3 DEF_STRA3
7 PsiBlast_PDB 79.7468% -9 - C4 -2AI7 4.2 DEF_STRR6
6 PsiBlast_PDB 79.6868% -8 - C4 -2AIE 4.0 DEF_STRR6
5 PsiBlast_PDB 79.6868% -9 - C4 -3SW8 5.2 ?
121 HHSearch 77.8660% -50 - C4 -2OKL 6.3 DEF2_BACCR
120 HHSearch 77.7655% -48 - C4 -1LQY 6.5 DEF2_GEOSE
35 PsiBlast_CBE 63.1031% -42 - C4 -1VEY 3.3 DEF_LEPIN
40 PsiBlast_CBE 62.5231% -48 - C4 -1SV2 1.5 DEF_LEPIN
129 HHSearch 62.1730% -91 - C4 -1XEO 3.5 DEF_ECOLI
38 PsiBlast_CBE 61.4531% -47 - C4 -1VEV 3.0 DEF_LEPIN
34 PsiBlast_CBE 61.2231% -46 - C4 -1VEZ 3.2 DEF_LEPIN
37 PsiBlast_CBE 60.7431% -45 - C4 -1VEV 2.7 DEF_LEPIN
32 PsiBlast_CBE 60.6631% -51 - C4 -1Y6H 3.4 DEF_LEPIN
31 PsiBlast_CBE 60.4031% -40 - C4 -1Y6H 3.0 DEF_LEPIN
33 PsiBlast_CBE 60.3531% -47 - C4 -1VEZ 3.2 DEF_LEPIN
36 PsiBlast_CBE 60.3031% -48 - C4 -1VEY 3.1 DEF_LEPIN