@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XXS4: (2018-01-05 )
MTKLSEMLQETTQFILDKGVKEIDFGLILGSGLGELADEIEDAVMISYDEIPFFPVSTVVGHAGKLVYGSLAGKKVLAMQGRFHYYEGHSMQTVTYPVRVMAGLGAHSVIVTNACGGVNESFVPGDLMLITDHINFTGENPLIGPNEDAMGPRFPDMSQAYTPDYQATAKAAAEKLGLDLKEGVYMGYSGPTYETPAEIRMSRTIGADAVGMSTVPEVIVAAHSGLKVLGISCITNLAAGMQANLSHEEVVETTQRVKQSFKALVKETLTLL

Atome Classification :

(52 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P1G_A_5(2AI1)
PNPH_BOVIN
[Raw transfer]




P1D_A_5(2AI2)
PNPH_BOVIN
[Raw transfer]




9DI_G_7(1A9P)
PNPH_BOVIN
[Raw transfer]




NOS_G_7(1A9S)
PNPH_BOVIN
[Raw transfer]




IMH_A_4(1B8O)
PNPH_BOVIN
[Raw transfer]




NOS_C_7(3FAZ)
?
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




P2G_A_5(2AI3)
PNPH_BOVIN
[Raw transfer]




IMH_M_13(1RR6)
PNPH_HUMAN
[Raw transfer]




IMG_A_4(1B8N)
PNPH_BOVIN
[Raw transfer]




NOS_E_5(1RCT)
PNPH_HUMAN
[Raw transfer]




GMP_M_13(1RFG)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1RT9)
PNPH_HUMAN
[Raw transfer]




DIH_M_13(1RSZ)
PNPH_HUMAN
[Raw transfer]




3DG_M_13(1V45)
PNPH_HUMAN
[Raw transfer]




DIH_A_5(3BGS)
PNPH_HUMAN
[Raw transfer]




R1P_C_8(3FB1)
?
[Raw transfer]




22A_A_2(3K8Q)
PNPH_HUMAN
[Raw transfer]




IMH_E_3(2Q7O)
PNPH_HUMAN
[Raw transfer]




R1P_A_4(3FB1)
?
[Raw transfer]




R1P_D_4(1A9T)
PNPH_BOVIN
[Raw transfer]




IMH_M_13(1PF7)
PNPH_HUMAN
[Raw transfer]




GU7_A_5(1FXU)
PNPH_BOVIN
[Raw transfer]




IMH_D_4(2ON6)
PNPH_HUMAN
[Raw transfer]




R1P_B_6(3FB1)
?
[Raw transfer]




HPA_A_2(3LBA)
?
[Raw transfer]




HPA_A_2(3LBA)
?
[Raw transfer]




HPA_A_4(1VFN)
PNPH_BOVIN
[Raw transfer]




2DI_M_13(1V3Q)
PNPH_HUMAN
[Raw transfer]




MES_A_2(5CXS)
?
[Raw transfer]




9HX_E_5(1I80)
PUNA_MYCTU
[Raw transfer]




TRS_B_8(3KHS)
?
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




TRS_D_12(3KHS)
?
[Raw transfer]




TRS_C_10(3KHS)
?
[Raw transfer]




TRS_B_8(3KHS)
?
[Raw transfer]




TRS_D_12(3KHS)
?
[Raw transfer]




9D9_C_9(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_B_7(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




116 HHSearch 96.4664%-126 - C4 -3LBA 3.4 ?
2 PsiBlast_PDB 95.8563%-127 - C4 -3LBA 3.4 ?
111 HHSearch 92.8146%-105 - C4 -4M1E - ? -
110 HHSearch 92.4346%-108 - C4 -4M1E - ? -
117 HHSearch 91.3064%-137 - C4 -3LA8 - ? -
1 PsiBlast_PDB 90.7863%-139 - C4 -3LA8 - ? -
123 HHSearch 89.9447% -98 * C4 *3FUC 4.3 PNPH_BOVIN
113 HHSearch 89.3148% -85 - C4 -4LNA - ? -
12 PsiBlast_PDB 89.0648% -89 - C4 -1B8N 4.5 PNPH_BOVIN
118 HHSearch 88.8247% -98 - C4 -4NSN - ? -
8 PsiBlast_PDB 88.4548% -86 - C4 -1A9S 5.4 PNPH_BOVIN
13 PsiBlast_PDB 88.1848% -88 - C4 -1B8O 5.5 PNPH_BOVIN
7 PsiBlast_PDB 88.1848% -87 - C4 -1A9P 5.2 PNPH_BOVIN
10 PsiBlast_PDB 88.1448% -88 - C4 -4PNP - PNPH_BOVIN -
59 PsiBlast_CBE 88.1146%-101 - C4 -3PHB - PNPH_HUMAN -
34 PsiBlast_CBE 88.0746% -97 - C4 -3K8O - PNPH_HUMAN -
5 PsiBlast_PDB 88.0748% -88 - C4 -1A9T 4.7 PNPH_BOVIN
36 PsiBlast_CBE 87.9146% -97 - C4 -3K8O - PNPH_HUMAN -
15 PsiBlast_PDB 87.9048%-100 - C4 -2AI1 8.5 PNPH_BOVIN
56 PsiBlast_CBE 87.8046% -94 - C4 -3PHB - PNPH_HUMAN -
22 PsiBlast_CBE 87.7648% -97 - C4 -3FUC 4.4 PNPH_BOVIN
16 PsiBlast_PDB 87.6648% -94 - C4 -2AI2 7.2 PNPH_BOVIN
21 PsiBlast_CBE 87.5648% -98 - C4 -3FUC 4.5 PNPH_BOVIN
14 PsiBlast_PDB 87.1848% -98 - C4 -3FUC 4.3 PNPH_BOVIN
18 PsiBlast_PDB 86.5248% -90 - C4 -1FXU 4.7 PNPH_BOVIN
45 PsiBlast_CBE 86.3046% -97 - C4 -1RSZ 3.1 PNPH_HUMAN
47 PsiBlast_CBE 86.1446% -98 - C4 -1PF7 3.3 PNPH_HUMAN
44 PsiBlast_CBE 86.1346% -95 - C4 -1RT9 3.0 PNPH_HUMAN
46 PsiBlast_CBE 85.9946% -94 - C4 -1RR6 5.0 PNPH_HUMAN
50 PsiBlast_CBE 85.8546% -99 - C4 -1V3Q 4.0 PNPH_HUMAN
53 PsiBlast_CBE 85.7746% -99 - C4 -1RCT 4.6 PNPH_HUMAN
17 PsiBlast_PDB 85.6048% -98 - C4 -2AI3 6.0 PNPH_BOVIN
39 PsiBlast_CBE 85.4146% -95 - C4 -3BGS 4.5 PNPH_HUMAN
52 PsiBlast_CBE 85.2346% -97 - C4 -1RFG 3.9 PNPH_HUMAN
75 PsiBlast_CBE 85.1948% -93 - C4 -5CXS 3.4 ?
114 HHSearch 85.1243% -96 - C4 -3KHS 2.5 ?
115 HHSearch 85.0243% -87 - C4 -3KHS 2.5 ?
40 PsiBlast_CBE 85.0146%-100 - C4 -2Q7O 4.5 PNPH_HUMAN
30 PsiBlast_CBE 84.7446% -98 - C4 -3K8Q 4.0 PNPH_HUMAN
48 PsiBlast_CBE 84.2946% -97 - C4 -1V45 3.9 PNPH_HUMAN
29 PsiBlast_CBE 84.2343%-100 - C4 -3KHS 2.5 ?
19 PsiBlast_PDB 83.9748% -99 - C4 -1VFN 5.5 PNPH_BOVIN
72 PsiBlast_CBE 83.6947%-114 - C4 -2ON6 3.6 PNPH_HUMAN
28 PsiBlast_CBE 83.6743%-102 - C4 -3KHS 2.5 ?
104 PsiBlast_CBE 83.4345% -86 - C4 -3FB1 4.6 ?
121 HHSearch 83.3342% -99 - C4 -1TCV 2.8 ?
27 PsiBlast_CBE 82.9443%-104 - C4 -3KHS 2.5 ?
105 PsiBlast_CBE 82.0545% -91 - C4 -3FAZ 5.2 ?
102 PsiBlast_CBE 81.3945% -88 - C4 -3FB1 4.9 ?
125 HHSearch 77.6040% -59 - C4 -1G2O 6.1 PUNA_MYCTU
103 PsiBlast_CBE 77.0045% -91 - C4 -3FB1 3.4 ?
124 HHSearch 76.2140% -61 - C4 -1I80 3.3 PUNA_MYCTU